DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and Ddc

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_006514549.1 Gene:Ddc MGIID:94876 Length:513 Species:Mus musculus

Alignment Length:483 Identity:120/484 (25%)
Similarity:199/484 (41%) Gaps:95/484 (20%)


  Fly     7 GAETVDQIRDGLMDDWKILENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLKELINL---KVR 68
            |.|.||.|.|       .|:.:                 :.:.:.|.::|..|:.||..   :..
Mouse    43 GKEMVDYIAD-------YLDGI-----------------EGRPVYPDVEPGYLRPLIPATAPQEP 83

  Fly    69 ETENCSLAEIEELCQQ-VIHYSVKTSHGRFHNQLFGQLDPFGLA-GALVTEAMNGST----YTYE 127
            ||....:.:||::... |.|:         |:..|....|...: .|::.:.:.|:.    :::.
Mouse    84 ETYEDIIKDIEKIIMPGVTHW---------HSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWA 139

  Fly   128 VAPVFSLIETEVIATICK--------LAGYK-EGDGIFAPGGSTSNMYGMVLARYKI-------A 176
            .:|..:.:||.::..:.|        |||.. ||.|:.....|.:.:..::.||.|:       :
Mouse   140 ASPACTELETVMMDWLGKMLELPEAFLAGRAGEGGGVIQGSASEATLVALLAARTKVIRQLQAAS 204

  Fly   177 PEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGL-GSYNCVSVRTNERGQMLLDDLEAKIAEAK 240
            ||...:.:  |..||.:|||::|.|..:|    || |.....:|.::....|....|...:...|
Mouse   205 PEFTQAAI--MEKLVAYTSDQAHSSVERA----GLIGGIKLKAVPSDGNFSMRASALREALERDK 263

  Fly   241 ARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERAN 305
            |.|..||||..|.|||...:||::.....:..:.|:|||:||...|:|.:..:.|.|:.|:|.|:
Mouse   264 AAGLIPFFVVATLGTTSCCSFDNLLEVGPICNQEGVWLHIDAAYAGSAFICPEFRYLLNGVEFAD 328

  Fly   306 SFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFY------DVSYDTGNK--SV 362
            ||::||||.:.....||....:      .|.:.|.|   |..|..|      |..:.|..:  .:
Mouse   329 SFNFNPHKWLLVNFDCSAMWVK------RRTDLTGA---FNMDPVYLKHSHQDSGFITDYRHWQI 384

  Fly   363 QCGRKIDAFKFWLMLKARGYGKYGLM--VDHAIHIARLLEGKLRQRGDRFRLVIPEHEYSNVCFW 425
            ..||:..:.|.|.:.  |.||..||.  :...:.::...|..:|| ..||. :..|.....||| 
Mouse   385 PLGRRFRSLKMWFVF--RMYGVKGLQAYIRKHVELSHEFESLVRQ-DPRFE-ICTEVILGLVCF- 444

  Fly   426 FIPKAMRVSSEEETPEWWSRLYTVAPKI 453
                  |:....|..|...:....|.||
Mouse   445 ------RLKGSNELNETLLQRINSAKKI 466

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 102/390 (26%)
DdcXP_006514549.1 Pyridoxal_deC 68..447 CDD:278699 107/414 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.