DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and hdc

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_017947930.1 Gene:hdc XenbaseID:XB-GENE-979207 Length:672 Species:Xenopus tropicalis

Alignment Length:443 Identity:106/444 (24%)
Similarity:191/444 (43%) Gaps:57/444 (13%)


  Fly    47 KQKIVPFLQPDKLKELI-NLKVRETENCS--LAEIEELCQQ-VIHYSVKTSHGRFHNQLFGQLDP 107
            ::::.|.:||..::.|: :....|:|:..  ..:||::... |:|:.....|.     .|..|..
 Frog    53 ERRVNPDVQPGYMRALLPDSAPVESESWERIFRDIEDIIMPGVVHWQSPHMHA-----YFPALTS 112

  Fly   108 F-GLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGY----------KEGDGIFAPGGS 161
            : .|.|.::.:|:|...:|:..:|..:.:|..|:..:.|:.|.          .:|.|:.....|
 Frog   113 WPSLLGDMLADAINCLGFTWASSPACTELEMNVMDWLAKMLGLPCHFLHHYPSSKGGGVLQSTVS 177

  Fly   162 TSNMYGMVLARYKIAPEVKTS------GMFGMRPLVLFTSDESHYSFVKAANWLGLGSYNCVSVR 220
            .|.:..::.||.....|:|||      .....| |:.:.|:::|.|..||      |..:.|.||
 Frog   178 ESTLIALLAARKNKILEMKTSEPDSDDSQLNSR-LIAYASNQAHSSVEKA------GLISLVKVR 235

  Fly   221 ---TNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDA 282
               .:|...:..|.|:|.:.|.:..|..|.||..|.|||.:.|||.:.....|..|..||||:||
 Frog   236 FLPVDENFCLRGDTLKAAVEEDRKNGLVPVFVCATLGTTGVCAFDYLAELGPVCAREKLWLHIDA 300

  Fly   283 CLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQ 347
            ...|.|.|..:.|:|:.|::.|:||::||.|.:.....|:.|..::..:|.:         .|..
 Frog   301 AYAGTAFLCPEFRTLMNGVDYADSFTFNPSKWMMVHFDCTAFWVKDKYKLQQ---------TFSV 356

  Fly   348 DKFYDVSYDTG------NKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQR 406
            :..|....:||      :..:...|:..:.|.|.::::.|.......:.|...:|:..|..:  .
 Frog   357 NPIYLRHANTGAATDFMHWQIPLSRRFRSLKLWFVIRSFGVKNLQAHIRHGAELAKYFESLV--T 419

  Fly   407 GDRFRLVIPEHEYSNVCFWFIPKAMRVSSEEETPEWW--SRLYTVAPKIKEQM 457
            .|:...|..:.....|.|..  |...|.:||...|..  .::|.|...|.:::
 Frog   420 SDQMFEVPAKRHLGLVVFRL--KGPNVLTEEVLAELTKSGKMYLVPATINDEL 470

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 95/390 (24%)
hdcXP_017947930.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.