DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and gad1.1

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_004917766.1 Gene:gad1.1 XenbaseID:XB-GENE-1011699 Length:590 Species:Xenopus tropicalis

Alignment Length:496 Identity:233/497 (47%)
Similarity:321/497 (65%) Gaps:30/497 (6%)


  Fly    23 KILENVFHLLRKEDTFCVDPQKWDKQ-KIVPFLQPDKLKELI---NLKVRETENCSLAEIEELCQ 83
            ::::.:.:.:||  ||       |:. |::.|..|.:|.|.|   ||::.:... ||.:|...|:
 Frog   115 EVVDILLNYVRK--TF-------DRSTKVLDFHHPHQLLEGIEGFNLELSDNPE-SLEQILVDCR 169

  Fly    84 QVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAG 148
            ..:.|.|:|.|.||.|||...||..||||..:|...|.:.:|||:||||.|:|...:..:.::.|
 Frog   170 DTLKYGVRTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLRKMREIIG 234

  Fly   149 Y--KEGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGL 211
            :  |:|||||:|||:.||||.::.||||..|||||.||..:..||||||:.||||..|....||.
 Frog   235 WTEKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPRLVLFTSEHSHYSIKKTGAALGF 299

  Fly   212 GSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGL 276
            ||.|.:.|:|||||:::..||||||.|||.:|..|.:||.||||||.||||.|:..||:.|::.|
 Frog   300 GSENVIMVKTNERGKIIPADLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPISEIADICEKYNL 364

  Fly   277 WLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEA 341
            ||||||..||..|:|.::|..:.|:|||||.:|||||.:|..||||..|.||.| :|:.||...|
 Frog   365 WLHVDAAWGGGLLMSRRHRHKLDGIERANSVTWNPHKMMGVLLQCSAILLREKG-ILQGCNQMCA 428

  Fly   342 HYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQR 406
            .|||||||.||:|||||:|::||||.:|.||||||.||:|...:...::..:.:|..|..|:..|
 Frog   429 GYLFQQDKQYDISYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFEAQINKCLELAEYLYSKIYNR 493

  Fly   407 GDRFRLV---IPEHEYSNVCFWFIPKAMR-VSSEEETPEWWSRLYTVAPKIKEQMAHSGTLMIGY 467
             :.|.:|   :|||  :|||||:||.::| :.:.||..|   :|:.||||||..|..|||.|:||
 Frog   494 -EGFEMVFNGVPEH--TNVCFWYIPPSLRGMPNNEEKQE---KLHRVAPKIKALMMESGTTMVGY 552

  Fly   468 SPLKAKNLGNFFRMVFTCFPILKSKELDFILDEIERLGEKI 508
            .|...|  .||||||.: .|.....::||:::||||||:::
 Frog   553 QPQGDK--ANFFRMVIS-NPAATKSDIDFLVEEIERLGQEL 590

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 209/413 (51%)
gad1.1XP_004917766.1 Pyridoxal_deC 140..514 CDD:278699 189/379 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.