DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and gad2

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_017950266.1 Gene:gad2 XenbaseID:XB-GENE-976598 Length:588 Species:Xenopus tropicalis

Alignment Length:472 Identity:206/473 (44%)
Similarity:305/473 (64%) Gaps:16/473 (3%)


  Fly    43 QKWDKQ-KIVPFLQPDKLKELINLKVRETENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLD 106
            |.:|:. |::.|..|::|.:..|.::.|... ||..|...|:..:.|::||.|.|:.|||...||
 Frog   127 QTFDRSTKVIDFHYPNELLQAYNWELSEQPQ-SLDGILLNCKTTLKYAIKTGHPRYFNQLSTGLD 190

  Fly   107 PFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYK--EGDGIFAPGGSTSNMYGMV 169
            ..|||...:|...|.:.:|||:||||.|:|...:..:.::.|:.  .|||||:|||:.||:|.|:
 Frog   191 MVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREMIGWPGGSGDGIFSPGGAISNLYAML 255

  Fly   170 LARYKIAPEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEA 234
            :||:|:.||||..||..:..||.|||:.||:|..|.|..||:|:.:.:.::.:|||:::..|||.
 Frog   256 IARFKMFPEVKEKGMAALPRLVAFTSEHSHFSVKKGAAALGIGTDSVILIKADERGRLIPSDLER 320

  Fly   235 KIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIA 299
            :|.|||..|..||||:.||||||.||||.:...||:.:::.:|:||||..||..|:|.|::..:.
 Frog   321 RIIEAKQNGYVPFFVSATAGTTVYGAFDPLVSIADICKKYRIWMHVDAAWGGGLLMSRKHKWKLN 385

  Fly   300 GLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQC 364
            |.:||||.:|||||.:|.|||||..|.||.| |::.||...|.|||||||.||:|||||:|::||
 Frog   386 GADRANSVTWNPHKMMGVPLQCSALLVREEG-LMQNCNQMHASYLFQQDKHYDLSYDTGDKALQC 449

  Fly   365 GRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQRGDRFRLVI---PEHEYSNVCFWF 426
            ||.:|.||.|||.:|:|...:...:|..:.::..|..|::.| :.:.:||   |:|  :|||||:
 Frog   450 GRHVDIFKLWLMWRAKGTTGFEAHIDKCLELSEYLYNKIKNR-EGYEMVIEGKPQH--TNVCFWY 511

  Fly   427 IPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGTLMIGYSPLKAKNLGNFFRMVFTCFPILKS 491
            :|.::|  :.|:..|..:||..|||.||.:|...||.|:.|.|...|  |||||||.: .|....
 Frog   512 VPPSLR--NMEDNEERMNRLSKVAPIIKARMMEYGTTMVSYQPHGDK--GNFFRMVIS-NPAAAH 571

  Fly   492 KELDFILDEIERLGEKI 508
            :::||:::||||||:.:
 Frog   572 QDIDFLIEEIERLGQDL 588

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 187/412 (45%)
gad2XP_017950266.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.