DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and csad

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_017947211.1 Gene:csad XenbaseID:XB-GENE-1012440 Length:490 Species:Xenopus tropicalis

Alignment Length:463 Identity:219/464 (47%)
Similarity:311/464 (67%) Gaps:14/464 (3%)


  Fly    49 KIVPFLQPDKLKELINLKVR---ETENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPFGL 110
            |:..:::|::|.|::|||::   |::...|.    .|:.::.:||||.|.||.||||..||...|
 Frog    39 KVCEWMEPEQLHEILNLKLQRHGESQQALLG----YCRDIVRFSVKTGHPRFFNQLFSGLDRHAL 99

  Fly   111 AGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYKEGDGIFAPGGSTSNMYGMVLARYKI 175
            .|.:::|.:|.|.|||||||||.|:|.||:.|:....|:..|||||.||||.||||.:.:||::.
 Frog   100 TGRILSETLNTSQYTYEVAPVFVLMEEEVLRTLRHYVGWTAGDGIFCPGGSISNMYAINVARFQR 164

  Fly   176 APEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAK 240
            .|..|..|:..:..:.:||:.|||||..|.|.::|:|:.|.:.|:||:||:||.:|||.:|.:::
 Frog   165 FPHAKEKGLSSLPRMTIFTTQESHYSVRKGAAFMGIGTDNIIIVQTNDRGKMLPEDLENQIQKSR 229

  Fly   241 ARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERAN 305
            :.|..||.|:.|.|||||||||.:...|||.|:|||||||||..||:||||.|:|.|:.|:||||
 Frog   230 SEGSVPFLVSATCGTTVLGAFDPLAEIADVCEQHGLWLHVDAAFGGSALLSNKHRHLLNGIERAN 294

  Fly   306 SFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDA 370
            |.:|||||.:|..||||.||..::..||:||::..|.||||.|||||:.||||:||:||||::|.
 Frog   295 SVTWNPHKMLGVGLQCSAFLLPDTTGLLQRCHAAYATYLFQTDKFYDLQYDTGDKSIQCGRRVDC 359

  Fly   371 FKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQRGDRFRLVIPEHEYSNVCFWFIPKAMRVSS 435
            .|.|||.||.|.......||.|:...|.|..::.:| :.|.|:: |.|:.|:|||::|.::|  .
 Frog   360 LKLWLMWKALGSEGLEKRVDKALEQTRYLMEEMTKR-EGFCLIM-EPEFVNLCFWYVPPSLR--H 420

  Fly   436 EEETPEWWSRLYTVAPKIKEQMAHSGTLMIGYSPLKAKNLGNFFRMVFTCFPILKSKELDFILDE 500
            ::.:|::|.||..|||.|||:|...|::|:||.|  ..|..||||.| ...|.:..::|||.|||
 Frog   421 QQNSPDYWERLGKVAPVIKERMMKKGSMMVGYQP--HGNRVNFFRQV-VVNPAVTKRDLDFFLDE 482

  Fly   501 IERLGEKI 508
            ||.|.|.:
 Frog   483 IELLAEDL 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 201/407 (49%)
csadXP_017947211.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.