DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5618 and sgpl1

DIOPT Version :9

Sequence 1:NP_649211.1 Gene:CG5618 / 40241 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_002943540.3 Gene:sgpl1 / 100379782 XenbaseID:XB-GENE-997685 Length:573 Species:Xenopus tropicalis


Alignment Length:339 Identity:71/339 - (20%)
Similarity:118/339 - (34%) Gaps:91/339 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 EVAPVFSLIETEVIATICKL-AGYKEGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPL 190
            ::.|....:|.||:...|.| .|..:..|....||:.|.:  |....|:.....|     |::..
 Frog   183 DIFPGVRKMEAEVVRMTCTLFTGGPDACGTVTSGGTESIL--MACKAYRDLAYEK-----GIKHP 240

  Fly   191 VLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGT 255
            .:.....:|.:|.|||::.|:   ..|.:..| :..|.:|....|.|.:|    ....:.|:|..
 Frog   241 EIVAPVSAHAAFEKAAHYFGM---KIVHIPLN-KATMQVDVKAMKRAISK----NTAMLVCSAPQ 297

  Fly   256 TVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAG---------LERANSFSWNP 311
            ...|..|.|...|::..::.|..||||||||..::..|.    ||         ::...|.|.:.
 Frog   298 FPHGVIDPIEEVAELALKYQLPFHVDACLGGFLIVFMKK----AGFPLKPFDFRVKGVTSISADT 358

  Fly   312 HKTIGAPLQCSLFLTRES----------------------------GRLLERCNSTEAHYLFQQD 348
            ||...||...|:.:..:.                            |.::..|.:|..|  ..:|
 Frog   359 HKYGYAPKGSSVIMYSDKKYRHYQFFVAPDWQGGIYASPAIAGSRPGGIIAACWATMMH--IGED 421

  Fly   349 KFYDVSYDTGNKSVQCGR----------------------------KIDAFKFWLMLKARGYGKY 385
            .:.:.:    .|.::..|                            |.|.|:....|.|:|:...
 Frog   422 GYIEAT----KKIIKAARFIETELRKIKEIFIFGKPEVSVIALGSNKFDIFRLSNSLTAKGWNLN 482

  Fly   386 GLMVDHAIHIARLL 399
            .|....:|||...|
 Frog   483 TLQFPSSIHICLTL 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 71/339 (21%)
sgpl1XP_002943540.3 DOPA_deC_like 152..514 CDD:99743 71/339 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.