DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and gad1a

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_002663350.1 Gene:gad1a ZFINID:ZDB-GENE-070912-472 Length:591 Species:Danio rerio

Alignment Length:494 Identity:225/495 (45%)
Similarity:318/495 (64%) Gaps:26/495 (5%)


  Fly    23 KILENVFHLLRKEDTFCVDPQKWDKQ-KIVPFLQPDKLKELINLKVRETENC----SLAEIEELC 82
            :::|.:.:.:||  ||       |:. |::.|..|.:|.|  .::....|.|    ||.:|...|
Zfish   116 EVVEILTNYVRK--TF-------DRSTKVLDFHHPHQLLE--GMEGFNLELCDQPESLEQILVDC 169

  Fly    83 QQVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLA 147
            :..:.|.|:|.|.||.|||...||..||||..:|...|.:.:|||:||||.|:|...:..:.::.
Zfish   170 RDTLKYGVRTGHPRFFNQLSSGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREIV 234

  Fly   148 GYK--EGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLG 210
            |:.  ||||||:|||:.||||.:::||||..||:|..||.....||||||:.||||..||:..||
Zfish   235 GWPNGEGDGIFSPGGAISNMYSVMVARYKHYPEIKIKGMAAAPRLVLFTSEHSHYSIKKASAVLG 299

  Fly   211 LGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHG 275
            .|:.|.:.:||:|||:::..|||||:.:||.:|..|.|||.|||:||.||||.||..||:.|::.
Zfish   300 FGTENLILLRTDERGRVIPADLEAKVIDAKQKGFVPMFVNATAGSTVYGAFDPINEIADICEKYN 364

  Fly   276 LWLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTE 340
            :|||||...||..|:|.|::..::|:|||||.:|||||.:|.|||||..|.||.| ||:.|||..
Zfish   365 MWLHVDGAWGGGLLMSRKHKHKLSGIERANSVTWNPHKMMGVPLQCSAILVREKG-LLQGCNSMC 428

  Fly   341 AHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQ 405
            |.||||.||.|||:||||:|::||||.:|.||||||.|::|...:...:|..:.::..|..|::.
Zfish   429 AGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKSKGTTGFEKHIDRCLELSEYLYHKIKN 493

  Fly   406 RGDRFRLVIP-EHEYSNVCFWFIPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGTLMIGYSP 469
            | :.:.:|.. |.:::|||||:||.::|:..:.|  |...||:.||||||..|...||.|:||.|
Zfish   494 R-EGYEMVFQGEPQHTNVCFWYIPPSLRLLPDGE--EKRHRLHKVAPKIKALMMECGTTMVGYQP 555

  Fly   470 LKAKNLGNFFRMVFTCFPILKSKELDFILDEIERLGEKI 508
            ...|  .||||||.: .|.:...::||::|||||||:.:
Zfish   556 QGEK--VNFFRMVVS-NPAVTRSDIDFLIDEIERLGQDL 591

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 201/410 (49%)
gad1aXP_002663350.1 Pyridoxal_deC 141..515 CDD:278699 180/378 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.