DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and gad1.2

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_012819752.1 Gene:gad1.2 XenbaseID:XB-GENE-5830282 Length:554 Species:Xenopus tropicalis

Alignment Length:510 Identity:225/511 (44%)
Similarity:324/511 (63%) Gaps:34/511 (7%)


  Fly     6 DGAETVDQIRDGLMDDWKILENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLKELI---NLKV 67
            :|.:..:|.   |::..:||.|  |:.:..|         .:.|::.|..|.:|.|.:   ||::
 Frog    68 NGEKCTEQF---LIEVLRILLN--HIKKTYD---------GESKVLDFHHPHQLLEGLEGFNLEL 118

  Fly    68 RETENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVF 132
            .:... .|.:|...|...:.||:||.|.|:.|||...||..||||..:|...|.:.:|||:||||
 Frog   119 SDQPE-PLEQILVDCSDTLKYSIKTGHPRYFNQLSCGLDIIGLAGEWLTATANTNMFTYEIAPVF 182

  Fly   133 SLIETEVIATICKLAGY--KEGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTS 195
            .::|..|:..:.::.|:  .|.||||:|||:.||:|.:..||||..|.|||.||..:..:|:|||
 Frog   183 IIMEEIVLKKMQEIIGWGENEADGIFSPGGTISNLYSLQAARYKYFPMVKTKGMAALPQIVIFTS 247

  Fly   196 DESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGA 260
            ::|||||.||:..||:|:.|.::::.:|||:|:..|||.||.:||.:|..||:|:.||||||.||
 Frog   248 EQSHYSFKKASAILGIGTDNVIAIKCDERGKMIPSDLEDKILKAKRQGQHPFYVSATAGTTVYGA 312

  Fly   261 FDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFL 325
            ||.:...||:.:|:|||:||||..||..|||.|:|..:.|:|||||.:|||||.:|.|||||..|
 Frog   313 FDPLITIADICKRYGLWMHVDAAWGGGLLLSKKHRYKMNGIERANSVTWNPHKIMGVPLQCSAIL 377

  Fly   326 TRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVD 390
            .|:.| ||:.||...|.||||.||.||.:||||:|::||||.:|.||.|||.||:|...:.|.::
 Frog   378 IRQKG-LLQACNQQCADYLFQMDKPYDTAYDTGDKTIQCGRHVDIFKLWLMWKAKGSCGFELQIN 441

  Fly   391 HAIHIARLLEGKLRQRGDRFRLVIPEH-EYSNVCFWFIPKAMRVSSEEETP---EWWSRLYTVAP 451
            ..:.::..|..||:.:.: |.||..:. ||:|||||:||.::     |..|   ||.:||:.:||
 Frog   442 RCLELSEYLYNKLQSKSN-FELVFRDKPEYTNVCFWYIPPSL-----EHVPRDKEWKARLHKIAP 500

  Fly   452 KIKEQMAHSGTLMIGYSPLKAKNLGNFFRMVFTCFPILKSKELDFILDEIERLGE 506
            :||.:|...||:|:.|.|...|  .|||||||: .|..|..::||:|:||||||:
 Frog   501 QIKARMMEEGTVMVSYQPQGDK--PNFFRMVFS-NPASKKSDVDFLLEEIERLGK 552

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 199/413 (48%)
gad1.2XP_012819752.1 Pyridoxal_deC 104..478 CDD:278699 178/377 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.