DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and zgc:163121

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001083039.2 Gene:zgc:163121 ZFINID:ZDB-GENE-070424-80 Length:546 Species:Danio rerio

Alignment Length:540 Identity:239/541 (44%)
Similarity:322/541 (60%) Gaps:54/541 (10%)


  Fly     3 ESVDGAETVDQIRDGLMDDWKILENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLKELINLKV 67
            :|.....:::...|||..|...:.:.|..:..:|..   |.:..::....|||     ||:|:.:
Zfish    21 KSKQDTSSLENTDDGLKYDSGRVTHDFSCIHSKDLL---PAEDGEEATKHFLQ-----ELVNILL 77

  Fly    68 --------RET---------------ENCSLA------EIEEL---CQQVIHYSVKTSHGRFHNQ 100
                    |.|               |..||.      .:|:|   |:..:.|.|||.|.||.||
Zfish    78 AYISKSLKRSTKVLDFHYPHQLNEGLEGFSLELPDQPDNLEQLLVDCRDTLKYGVKTGHPRFFNQ 142

  Fly   101 LFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYKE--GDGIFAPGGSTS 163
            |...||..||||..:|...|.:.:|||::|||.|:|..|:..:..:.|:.|  |||||.||||.|
Zfish   143 LSTGLDIVGLAGEWLTSTANTNMFTYEISPVFILMEEVVLRKMHTIIGWPEEDGDGIFCPGGSMS 207

  Fly   164 NMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQML 228
            |:|.::|||:.:.|.|||.||..:..|.:|||..||||..|:|..||:|:.|.:.||.:|||:|:
Zfish   208 NLYSVLLARFHLFPAVKTHGMCAIPRLAMFTSAHSHYSIKKSAAVLGIGTENVIVVRCDERGKMI 272

  Fly   229 LDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAK 293
            ..:|.:.|.|||::|..||:||.||||||.||||.::..||:.|.||||:||||..||..|||.|
Zfish   273 SSELNSSIEEAKSKGLVPFYVNATAGTTVYGAFDPLHKIADICEHHGLWMHVDAAWGGGLLLSNK 337

  Fly   294 NRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTG 358
            :|..:.|:|||:|.:|||||.:|.|||||..|.:..| ||::||...|.||||.||.|:||||||
Zfish   338 HRVKLHGIERAHSVTWNPHKMMGVPLQCSTILVKRKG-LLQQCNQLCAEYLFQPDKHYEVSYDTG 401

  Fly   359 NKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQRGDRFRLVI---PEHEYS 420
            :||:||||.:|.||.|||.||:|...:...|:|.:..|..|..||::|.| |:||.   |||  |
Zfish   402 DKSIQCGRHVDIFKLWLMWKAKGSEGFESQVNHCLENAEYLYYKLKRRTD-FQLVFKGKPEH--S 463

  Fly   421 NVCFWFIPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGTLMIGYSPLKAKNLGNFFRMVFTC 485
            |||||::||  ||.:....||....|:.||||||.:|...|..||||.||:.|  .||||.||: 
Zfish   464 NVCFWYLPK--RVQNIPLGPEREKELHMVAPKIKTKMMEEGFTMIGYQPLEDK--VNFFRCVFS- 523

  Fly   486 FPILKSKELDFILDEIERLG 505
            .|..:.:::||:||||.|||
Zfish   524 NPATQREDVDFLLDEIVRLG 543

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 209/412 (51%)
zgc:163121NP_001083039.2 Pyridoxal_deC 96..469 CDD:278699 185/377 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.