DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and sgpl1

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_005156777.1 Gene:sgpl1 ZFINID:ZDB-GENE-070410-24 Length:574 Species:Danio rerio

Alignment Length:533 Identity:98/534 (18%)
Similarity:178/534 (33%) Gaps:164/534 (31%)


  Fly    23 KILENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLKELINLKVRETENCSLAEIEELCQQVIH 87
            ::.:..|.::||                :||:.. .::..:| |..:..:.||..::|   .:.:
Zfish    66 RVKKQFFRIIRK----------------IPFIGA-SIQNQLN-KALDDMSMSLCTLKE---GMSY 109

  Fly    88 YSVKTSHGRFHNQLFGQLDPF-----------GLAGA----------LVTEAMNGSTYTY----E 127
            ..:..:.|..|.||..::..:           .::||          |:.:......:|.    :
Zfish   110 TKLLPAQGLTHKQLLDKIREYETLSEVNWAKGKVSGAVYWGDEKLTDLLVKVYGEFAWTNPLHPD 174

  Fly   128 VAPVFSLIETEVIATICKL-AGYKEGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLV 191
            :.|....:|.||:...|.| .|..:..|....||:.|.:  |....|:.....:     |::...
Zfish   175 IFPGVRKMEAEVVRMTCALFNGGPDSCGTVTSGGTESIL--MACKAYRDMAHER-----GIKHPE 232

  Fly   192 LFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKI---AEAKARGGEPFFVNCTA 253
            :......|.:|.|||::.|:...:           :.||:...|:   |..:|.......:.|:|
Zfish   233 IIAPISVHAAFDKAAHYFGMKLIH-----------VPLDNKTMKVDVKAMRRAITKNTAMLVCSA 286

  Fly   254 GTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERA---------NSFSW 309
            .....|..|.:...|.:..::.:..||||||||..::..:.    ||.:.|         .|.|.
Zfish   287 PQFPHGIMDPVEEVAKLAVKYNIPFHVDACLGGFLIVFMEK----AGFKLAPFDFRVKGVTSISA 347

  Fly   310 NPHKTIGAPLQCS--LFLTRE--------------------------SGRLLERCNSTEAHYLFQ 346
            :.||...||...|  |:..|:                          .|.::..|.:|..|   .
Zfish   348 DTHKYGYAPKGSSVVLYSNRKFRHYQYFVAPDWQGGIYASPSMAGSRPGGIIAACWATMMH---M 409

  Fly   347 QDKFYDVSYDTGNKSVQCGRKI----------------------------DAFKFWLMLKARGYG 383
            .:|.|   .:...|.|:..|||                            |.|:....|.::|:.
Zfish   410 GEKGY---VEATRKVVETTRKIKTGIRKIDGVFVFGDPEVSVVALGSDDFDIFRLSNALTSKGWN 471

  Fly   384 KYGLMVDHAIHIARLLEGKLRQRGDRFRLVIPEHEYSNVCFWFIPK-----AMRVSSEEETPEWW 443
            ...|....:|||.                |...|..|.|...||..     |:.:.:.:|.....
Zfish   472 LNTLQFPSSIHIC----------------VTMLHTQSGVAEQFISDVKKEVAIIMKNPKEKTTGM 520

  Fly   444 SRLYTVAPKIKEQ 456
            ..:|.:|..|.::
Zfish   521 GAIYGMAQSIPDR 533

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 87/460 (19%)
sgpl1XP_005156777.1 DOPA_deC_like 143..504 CDD:99743 79/405 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.