DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn77Ba and SERPINB7

DIOPT Version :9

Sequence 1:NP_649205.3 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_003775.1 Gene:SERPINB7 / 8710 HGNCID:13902 Length:380 Species:Homo sapiens


Alignment Length:402 Identity:104/402 - (25%)
Similarity:190/402 - (47%) Gaps:45/402 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LVSISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINV- 132
            :.|::....:|..:|.:  .::..:.|.:...|..|:::.|.|:..|::.::.:|:.|.|.:|. 
Human     1 MASLAAANAEFCFNLFR--EMDDNQGNGNVFFSSLSLFAALALVRLGAQDDSLSQIDKLLHVNTA 63

  Fly   133 --------EDEKLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQN-YNVQPME 188
                    ....|:...|...|.:|.:....:::.:..::..|.|....:|.:..:. |:.:...
Human    64 SGYGNSSNSQSGLQSQLKRVFSDINASHKDYDLSIVNGLFAEKVYGFHKDYIECAEKLYDAKVER 128

  Fly   189 VDF--YSPDSVIQINEDTNRTTRGLIPYTILPQDVYG-------AKMFLLSSLYFKGQWKFPFNK 244
            |||  :..|:...||:.....|.|.|      ::|.|       |.|.|::::||||:|:..|.|
Human   129 VDFTNHLEDTRRNINKWVENETHGKI------KNVIGEGGISSSAVMVLVNAVYFKGKWQSAFTK 187

  Fly   245 TLTREEPFFSESGEVIGK-IPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFK 308
            :.|....|  :|.:..|| :.||.||..| .:|.:|.....:|||.|  ...:.|.|:||:.  .
Human   188 SETINCHF--KSPKCSGKAVAMMHQERKF-NLSVIEDPSMKILELRY--NGGINMYVLLPEN--D 245

  Fly   309 LNDVANNLKALGLRPILQRLAAFRN-RASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDEN 372
            |:::.|.|       ..|.|..:.| |......|||..|:|....::.:|..|..:|::|:|||:
Human   246 LSEIENKL-------TFQNLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFDES 303

  Fly   373 TANLDRMSSG--LFAKLVVHSTKIIVDEQGTTAGAVTEAALANKATPPKFLLNRPFQYMIVEKAT 435
            .|:|..::||  |:...::|.:.|.|.|:||.|.|.|.:.:..|..|...|......::.|.:..
Human   304 KADLSGIASGGRLYISRMMHKSYIEVTEEGTEATAATGSNIVEKQLPQSTLFRADHPFLFVIRKD 368

  Fly   436 GLLLFAGQVRNP 447
            .::||:|:|..|
Human   369 DIILFSGKVSCP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_649205.3 serpin77Ba-like_insects 72..447 CDD:381062 102/397 (26%)
SERPINB7NP_003775.1 serpinB7_megsin 1..380 CDD:381032 103/400 (26%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - -
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.