DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Spn77Ba and Spn43Ab

Sequence 1:NP_001287128.1 Gene:Spn77Ba FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001027395.1 Gene:Spn43Ab FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster

Alignment Length:391 Identity:99/392 (25%)
Similarity:169/392 (43%) Gaps:58/392 (15%)


  Fly    80 ALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVED----EKLRGA 140
            |.||..  :|..:..|::.:|||.::.|.:.|.:.|::|:|.::|::.||:...|    .:..|:
  Fly    33 AADLYN--AVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLRLGPGDADAVSQRSGS 95

  Fly   141 YKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQ---NYNVQPMEVDFYSP---DSVIQ 199
            |:      ...|..........||..:....|.::||..|   :.|:.  ::||:.|   .:...
  Fly    96 YQ------QALTRDNNFRLANNIYINENLEFKGSFRDVAQRQFDSNID--KLDFHPPYNKRTADG 152

  Fly   200 INEDTNRTTRGLIPYTILPQDVYGAKMF-------LLSSLYFKGQWKFPFNKTLTREEPFFSESG 257
            ||......|.|.|      .|:..|::.       :::.:.:...|:..|....|.:..|.:.||
  Fly   153 INRAVATKTNGKI------TDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSG 211

  Fly   258 EVIGKIPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLR 322
            :.: |:..|....||.| :.|..||..|:||||...| .:|:::||.|    .|        |||
  Fly   212 QSV-KVDTMWTLQNFNY-AEVNSLDAKVVELPYQNPD-FSMLLLLPNR----KD--------GLR 261

  Fly   323 PILQRLAAFRNRASE-----DNEVEVMMPKFVTATDFTLKGVLIQMGIRDLF--DENTANLDRMS 380
            .:.|.|:. :|..:|     ..:|||::|||.......|:|...::|:..:|  |.:..|:.||.
  Fly   262 SLQQSLSG-KNLLAEIGAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSRDGDFGNMYRMF 325

  Fly   381 SGLFAKLVVHSTKIIVDEQGTTAGAVTEAALANKATPPKFLLNRPFQYMIVEKATGLLLFAGQVR 445
            ...|...|.|...:.|.|.|......|.......:...||..:.||.:.|..|.:  :.|.|.:.
  Fly   326 VSHFINAVEHKANVEVTEAGVDQPLETGLLKGLFSRSKKFEADHPFVFAIKYKDS--IAFIGHIA 388

  Fly   446 N 446
            |
  Fly   389 N 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 98/388 (25%)
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 98/388 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C22676974
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D556621at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11461
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.