DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: gogo and Thsd1

Sequence 1:NP_649200.2 Gene:gogo FlyBaseID:FBgn0052227 Length:1272 Species:Drosophila melanogaster
Sequence 2:NP_062522.1 Gene:Thsd1 MGIID:1929096 Length:851 Species:Mus musculus

Alignment Length:1038 Identity:210/1039 (20%)
Similarity:329/1039 (32%) Gaps:327/1039 (31%)


  Fly    36 SSIMLLLLSGTSHVLAVRKGRLMSPSTFTALSGDLHVQIQFNGNEMSSQAEEEHTIGGGPSNEEP 100
            |:::|::|  ..:||...:..|:......||| |..|.:.|:                      .
Mouse     9 SNLLLVVL--CDYVLGEAEYLLLQEPVHVALS-DRTVSVGFH----------------------Y 48

  Fly   101 LSSSDGLKSRNNTIMSTLVISKIIDEVESPLEKGLTPGPEVTNTSQVVLHRKRKEVVQNIPLFPD 165
            ||..:| ..||.::|..          |:...:.||....:||.:|..|.               
Mouse    49 LSDVNG-TLRNVSVMLW----------EANTNRTLTTKYLLTNQAQGTLQ--------------- 87

  Fly   166 PRFNVTQVTVPCQTFLIGGRYEMQVVSNLKSVNRSEVTT--TLVPAQDERLHQTLDVRWP----- 223
                     ..|..|...|.|...::        .|||.  |.||..::...  |.|.||     
Mouse    88 ---------FECFYFKEAGDYWFVMI--------PEVTDNGTQVPLWEKSAF--LKVEWPVFHID 133

  Fly   224 ---SAEMIVSPVRLKTYPKHPVEVTLRFPEVNCNQSGSLALPEFWLELIYCGKDRSCNRNITPTS 285
               :|:......::..:...|:   ..||         :..|:..:::|:..:......::....
Mouse   134 LNRTAKAAEGTFQVGVFTTQPL---CLFP---------VDKPDMLVDVIFTDRLPEARASLGQPL 186

  Fly   286 VLFAEQIRGFPKNKSLHLGCELFGLAGNYAVQLRPMIPAQNVPTTRRLLSVDWSDEFVFNVYARS 350
            .:.|.:.....:.:.:..||...|:.....|.||.:.....:.:|.   .:|.:.:|.:.:....
Mouse   187 EIRASKRTKLTQGQWVEFGCAPVGVEAYVTVMLRLLGQDSVIASTG---PIDLAQKFGYKLMMAP 248

  Fly   351 IFPCDPHTGIGVLYEYPGCILEQGDRVRLYARLRADVASLKPPTSLHYVSEQRVVKSQHSLYFAC 415
            ...|:....:.||  .|.|:..|| .:.:|..     |..:|......|:|.|:...:....|.|
Mouse   249 EVTCESVLEVMVL--PPPCVFVQG-VLAVYKE-----APKRPEERTFQVAENRLPLGERRTVFNC 305

  Fly   416 EHFSEKYVEYCFVY--VSQAISGAVADVRMDCVPTLPVSDSDTGGWGPWSEWTPCSTNCLGGTRN 478
            ..|.....:|||.:  |.:....|     .:|:  |...:.:|  ||||..|:||||.|....|.
Mouse   306 TLFDVGKNKYCFNFGIVKKGHFSA-----KECM--LIQRNIET--WGPWQPWSPCSTTCGDAVRE 361

  Fly   479 RYRFC-DSPPPRYGAKFCEGPSVETQKCGKSIADTWDCIYETSGTVITKENSTEVSQEIGPGCRC 542
            |.|.| .|.|.|   ..|.|.|.||..|...     :|      .|......:.||.:       
Mouse   362 RRRLCVTSFPSR---PSCSGMSSETSPCSLE-----EC------AVFRPPGPSPVSPQ------- 405

  Fly   543 GCIVHLGSSKPKRIIAGATQSCPGRSFWLIQVDGEESISLALSFLRLP-CATQYIKVRDGPSLSS 606
                  ...|...::     :..|.|..|..:.....|:|...|.|.| |:|   .||.. |:.|
Mouse   406 ------DPVKSNNVV-----TVTGISLCLFIIFATVLITLWRRFGRAPKCST---PVRHN-SIHS 455

  Fly   607 TLLVELNGGGLILKGAGVPVVVDSTGGQLLVEFS--------AGDGPAGNATQEASPACTG---- 659
                              |....::..:.:.|.|        |||||.|      ||..||    
Mouse   456 ------------------PGFRKNSDEENICELSEPRGSFSDAGDGPRG------SPGDTGIPLT 496

  Fly   660 -----------------GFMANVQQ--------RLATRS----SNSSITLVAATRLSGKTRSVVH 695
                             .|.:|.|:        |||.:.    ....:|         :|..|.|
Mouse   497 YRCSASAPPEDEASGSESFQSNAQKIIPPLFSYRLAQQQLKEMKKKGLT---------ETTKVYH 552

  Fly   696 KSMSRLRFTLVHLSAM----------IFASIIIIISSLL---GAQYVVRYRKYHLAVARRQDEGS 747
            .|.|.|..|:|..:|.          ..||...|.|..|   ||                 ..|.
Mouse   553 VSQSPLTDTVVDATASPPLDLECPEEAAASKFRIKSPFLDQPGA-----------------GTGE 600

  Fly   748 RLHTPRASLSSLQGPPSRAMSTTTLLSEVIYMVKMR---------PKHHLRHSILRESVDAENLT 803
            |   |.:.|..:..||..|:|.:..|   |...::|         .:.|.|.|:.|.:.......
Mouse   601 R---PPSRLDGIVPPPGCAVSPSQTL---IRKSQIRSTGGRDGSSERCHSRSSLFRRTASFHETK 659

  Fly   804 KETEFKESDSQGMLAKCAEIKELGS-----------------SASMVTLRNER-------SSPAR 844
            :...|:|.....:..:  ::....|                 |..::..|.|.       |||..
Mouse   660 QSRPFRERSLSALTPR--QVPAYSSRMRTWDQMEDRCRPPSRSTHLLPERPEHFQGAGRTSSPLG 722

  Fly   845 SLDTGSIIG------SPSSAEAELAAVHSRSE----------SKDSPSDEPIEPPSCKDSARDSE 893
            .|.....:|      .|...:|.|.|...:.|          |..|.|.:...|...|||.:...
Mouse   723 PLSKSYTVGHPRRKPDPGDRQAGLVAGAEKMEPHRAHRGPSPSHRSASRKQSSPIFLKDSYQKVS 787

  Fly   894 SIISSGM-SSLCNSPPMN---------SKRLSKYSDRYDAVTLKLLSSRLDESLQDASSLLSV 946
            .:..|.. ...|.|.|::         |.||::...|...:.....|:..||:    :|.|||
Mouse   788 QLSPSHFRKDKCQSFPIHPEFAFYDNTSFRLTEAEQRMLDLPGYFGSNEEDET----TSTLSV 846

Known Domains:


GeneSequenceDomainRegion External IDIdentity
gogoNP_649200.2 TSP1 459..505 CDD:214559 22/47 (47%)
CUB <570..640 CDD:294042 14/71 (20%)
AKAP2_C 1049..>1146 CDD:291950
Thsd1NP_062522.1 TSP1 342..391 CDD:214559 23/57 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR16311
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.