DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: gogo and THSD1

Sequence 1:NP_649200.2 Gene:gogo FlyBaseID:FBgn0052227 Length:1272 Species:Drosophila melanogaster
Sequence 2:NP_061146.1 Gene:THSD1 HGNCID:17754 Length:852 Species:Homo sapiens

Alignment Length:990 Identity:194/991 (20%)
Similarity:300/991 (30%) Gaps:314/991 (32%)


  Fly    36 SSIMLLLLSGTSHVLAVRKGRLMSPSTFTALSGD-LHVQIQFNGNEMSSQAEEEHTIGGGPSNEE 99
            |:::|::|  ..:||...:..|:......|||.| ::|..|:                       
Human     9 SNLLLVVL--CDYVLGEAEYLLLREPGHVALSNDTVYVDFQY----------------------- 48

  Fly   100 PLSSSDGLKSRNNTIMSTLVISKIIDEVESPLEKGLTPGPEVTNTSQVVLHRKRKEVVQNIPLFP 164
                .||   .|.|:.:..|:.     :|:...:.:|....:||.||..|               
Human    49 ----FDG---ANGTLRNVSVLL-----LEANTNQTVTTKYLLTNQSQGTL--------------- 86

  Fly   165 DPRFNVTQVTVPCQTFLIGGRYEMQVVSNLKSVNRSEVTTTLVPAQDERLHQTLDVRWP------ 223
              :|.       |..|...|.|...:.        .|.|....|.........|.|.||      
Human    87 --KFE-------CFYFKEAGDYWFTMT--------PEATDNSTPFPWWEKSAFLKVEWPVFHVDL 134

  Fly   224 --SAEMIVSPVRLKTYPKHPVEVTLRFPEVNCNQSGSLALPEFWLELIYCGKDRSCNRNITPTSV 286
              ||:......::..:...|:   ..||         :..|...:::|:........||......
Human   135 NRSAKAAEGTFQVGLFTSQPL---CPFP---------VDKPNIVVDVIFTNSLPEARRNSRQPLE 187

  Fly   287 LFAEQIRGFPKNKSLHLGCELFGLAGNYAVQLRPMIPAQNVPTTRRLLSVDWSDEFVFNVYARSI 351
            :...:.....:.:.:..||...|......|.|: ::...:|.|:..  .:|.:.:|.:.:.....
Human   188 IRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLK-LLGRDSVITSTG--PIDLAQKFGYKLVMVPE 249

  Fly   352 FPCDPHTGIGVLYEYPGCILEQGDRVRLYARLRADVASLKPPTSLHYVSEQRVVKSQHSLYFACE 416
            ..|:  :|:.|....|.|...|| .|.::..     |...|.....:::|..:...:....|.|.
Human   250 LTCE--SGVEVTVLPPPCTFVQG-VVTVFKE-----APRYPGKRTIHLAENSLPLGERRTIFNCT 306

  Fly   417 HFSEKYVEYCFVYVSQAISGAVADVRMDCVPTLPVSDSDTGGWGPWSEWTPCSTNCLGGTRNRYR 481
            .|.....:|||.:...:.|...|  :.:|:    :...:|..||.|..|:.||..|..|.|.|.|
Human   307 LFDMGKNKYCFDFGISSRSHFSA--KEECM----LIQRNTETWGLWQPWSQCSATCGDGVRERRR 365

  Fly   482 FCDSPPPRYGAKFCEGPSVETQKCGKSIADTWDCIYETSGTVITKENSTEVSQEIGPGCRCGCIV 546
            .|.:..|  .:..|.|.|:|...|...     :|       ...:.:|....|..||        
Human   366 VCLTSFP--SSPVCPGMSLEASLCSLE-----EC-------AAFQPSSPSPLQPQGP-------- 408

  Fly   547 HLGSSKPKRIIAGATQSCPGRSFWLIQVDGEESISLALSFLR-LPCAT----------QYIKVRD 600
                .|...|:     :..|.|..|..:.....|:|...|.| ..|:|          .:.|..|
Human   409 ----VKSNNIV-----TVTGISLCLFIIIATVLITLWRRFGRPAKCSTPARHNSIHSPSFRKNSD 464

  Fly   601 GPSLSSTLLVELNGGGLILKGAGVPVVVDSTGGQLLVEFS-AGDGPAGNATQEASPACTG----- 659
            ..::..  |.|..|                       .|| .||||.|      ||..||     
Human   465 EENICE--LSEQRG-----------------------SFSDGGDGPTG------SPGDTGIPLTY 498

  Fly   660 ----------------GFMANVQQ--------RLATRS------------------SNSSIT--- 679
                            .|.:|.|:        |||.:.                  |.|.:|   
Human   499 RRSGPVPPEDDASGSESFQSNAQKIIPPLFSYRLAQQQLKEMKKKGLTETTKVYHVSQSPLTDTA 563

  Fly   680 ---------------LVAATRLSGKTR-------SVVHKSMSRLRFTLVHLSAMIFASIIIIISS 722
                           ..||.:...|:.       |...:..|||...:...|..|..|..:|..|
Human   564 IDAAPSAPLDLESPEEAAANKFRIKSPFPEQPAVSAGERPPSRLDLNVTQASCAISPSQTLIRKS 628

  Fly   723 LLGAQYVVRYRKYHLAVARRQDEGSRLHTPRASL-------SSLQGPP--SRAMSTTTLLSEVIY 778
                      :..|  |..|.....|.|...|..       .:.|..|  .|:|||.|......|
Human   629 ----------QARH--VGSRGGPSERSHARNAHFRRTASFHEARQARPFRERSMSTLTPRQAPAY 681

  Fly   779 MVKMRPKHHLRHSILRESVDAENLTKETE-FKE-SDSQGMLAKCAEIKELGSSASMVTLRNERSS 841
            ..:.|...........:|..|....::.| |:| |.::|.|....:...||             .
Human   682 SSRTRTCEQAEDRFRPQSRGAHLFPEKLEHFQEASGTRGPLNPLPKSYTLG-------------Q 733

  Fly   842 PARSLDTGSIIGSPSSAEAELAAVHSRSE---SKDSPSDEPIEPPSCKDSARDSESIISSGMSSL 903
            |.|..|.|       ..:|.|.|...|:|   ::..||      ||.|..:|...|.|       
Human   734 PLRKPDLG-------DHQAGLVAGIERTEPHRARRGPS------PSHKSVSRKQSSPI------- 778

  Fly   904 CNSPPMNSKRLSKYS 918
              ||..|.:|:|..|
Human   779 --SPKDNYQRVSSLS 791

Known Domains:


GeneSequenceDomainRegion External IDIdentity
gogoNP_649200.2 TSP1 459..505 CDD:214559 17/46 (37%)
CUB <570..640 CDD:294042 13/81 (16%)
AKAP2_C 1049..>1146 CDD:291950
THSD1NP_061146.1 TSP1 343..392 CDD:214559 18/56 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR16311
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.