DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: gogo and thsd1

Sequence 1:NP_649200.2 Gene:gogo FlyBaseID:FBgn0052227 Length:1272 Species:Drosophila melanogaster
Sequence 2:XP_002936776.2 Gene:thsd1 XenbaseID:XB-GENE-6044670 Length:848 Species:Xenopus tropicalis

Alignment Length:878 Identity:179/879 (20%)
Similarity:282/879 (32%) Gaps:233/879 (27%)


  Fly   177 CQTFLIGGRYEMQVVSNLKSVN----RSEVTTTLVPAQDERLHQTLDVRWPSAEMIVSPVRLKTY 237
            |..|:..|.|:.|:|...|:.:    ||.:.....|.....|::|.::|.....:..:.....|:
 Frog    91 CFHFIAAGLYQFQIVFTEKNQSNIDWRSSILNVTWPRFHIDLNRTSNIRSFQIGVFSNEQFCLTF 155

  Fly   238 P-KHP-----VEVTLRFPEVNCNQSGSLAL----------PEFWLELIYCGKDRS---CNRNITP 283
            | |||     ||.|..|.|:....|....|          |..|:| ..|...|.   ...::.|
 Frog   156 PDKHPRVLLEVEHTHSFQELEGLSSDRFMLYKTYKEIPLSPSQWVE-FECASVRPETFITVSLKP 219

  Fly   284 TSVLFAEQIRGFPKNKSLHLGCELFGLAGNYAVQLRPMIPAQNVPTTRRLLSVDWSDEFVFNVYA 348
            |   |:|.:..|                         |.|...|.|.|..|        |.:...
 Frog   220 T---FSESLIAF-------------------------MGPVDLVKTFRYKL--------VTSAEQ 248

  Fly   349 RSIFPCDPHTGIGVLYEYPGCILEQGDRVRLYAR-LRADVASLKPPTSLHYVSEQRVVKSQHSLY 412
            |    ||....:.|:  .|.|....| :|.:|.. ||   .|.:..|:|   :|..:........
 Frog   249 R----CDASVNVNVI--PPPCNYADG-KVIVYKEVLR---GSAETSTTL---AENVLQTGDKVAQ 300

  Fly   413 FACEHFSEKYVEYCFVYVSQAISGAVADV--RMDCVPTLPVSDSDTGGWGPWSEWTPCSTNCLGG 475
            |.|..|.....:|||.:.  ..||.:...  ..:||......:|    ||.|..|:|||..|..|
 Frog   301 FNCTLFDIGRNKYCFEFF--IASGKIYSFLGAKECVGIRREIES----WGLWQSWSPCSVTCGDG 359

  Fly   476 TRNRYRFC---DSPPPRYGAKFCEGPSVETQKCGKSIADTWDCIYETSGTVITKENSTEVSQEIG 537
            .|.|:|.|   .|..|.     |.|.:.||..|......:......:..|..:|:..|..:..|.
 Frog   360 ERERFRECLTTSSEKPA-----CRGRAKETSLCSLEECTSISVKPSSKSTTHSKDTKTSNTVTIA 419

  Fly   538 PGCRCGCIV------------HLGSSKPKRIIAGATQSCPGR-------------SF----WLIQ 573
            ....|..|:            |........:...:|.|..||             ||    ..:.
 Frog   420 GISLCLTIIIITIVITVWRKFHKTQKCSSTVKHNSTHSGNGRKNSDEENIYQMRESFSDMGEGLH 484

  Fly   574 VDGEESISLALSFLRLPCATQYIKVRDGPSLSSTLLVELNGGGLILKGAGVPVVVDSTGGQLLVE 638
            .:.|:::.:.|::      .|.::|.:..|......::.|...||     .|:.......|.|.|
 Frog   485 ENVEDTVDIPLTY------RQSMRVAEEKSGQENDNLQSNVQKLI-----PPIFSYRLAQQQLKE 538

  Fly   639 ------------FSAGDGPAGNATQE---ASPACTGGFMANVQQR-------LATRSSNSSITLV 681
                        :.....|..:...:   |.|:.|.....|:..:       :..|:.:......
 Frog   539 MKQRGLTEATKLYHVSQNPMSDTVVDGALAPPSVTDNCDDNIANKFRLQSPFIEQRNLHPQCHGE 603

  Fly   682 AATRLSGKTRSVVHKSMSRLRFTLVHLSAMIFASIIIIISSLLGAQYVVRY--RKYHLAVARRQD 744
            .:|.||      .::|.|..: ||.||            |..:.....|||  |.||.....|:.
 Frog   604 RSTPLS------PYQSTSPCQ-TLPHL------------SQFMNQDPKVRYIERPYHKNNNFRRT 649

  Fly   745 EGSRLHTPR-------ASLSSLQGPPSRAMSTTTLLSEVIYMVKMRPKHHLRHSILRESVDAENL 802
              |..|..:       .|||:|.  |.:.|:.........|....|.||.    .:|.....|:.
 Frog   650 --SSFHETKHNKPFRERSLSTLS--PRQTMAYNPRTRTWQYATTDRSKHR----SIRAEKSPEHF 706

  Fly   803 TKETEFKESDSQGMLAKCAEIKELGSSASMVTLRNERSSPARSLDTGSIIGSPSSAEAELAAVHS 867
            .|...| .:|.....:|...:....|...:::.|:                    |.|:.:.:..
 Frog   707 AKSANF-TADPVDFSSKNLYMWSSESKHDLISSRH--------------------AAAKASKLER 750

  Fly   868 RSESKDSPSDEPIE---------PPSCKDS-ARDSESIISSGMSSLCNSPPMNSKRLSKYSDRYD 922
            ..:::......||:         .|:.||| .|:|....:......|.|.|.    .:.|| .||
 Frog   751 LEQNRVKKGSSPIDKSWNRVQDYSPTFKDSYERNSPFSPAQNRREKCQSFPW----AADYS-FYD 810

  Fly   923 AVTLKL---------LSSRLDESLQDASSLLSV 946
            ..:.:|         |......:.:|.:|.||:
 Frog   811 NSSFRLTEAEQQMIDLPGYFASNEEDETSTLSM 843

Known Domains:


GeneSequenceDomainRegion External IDIdentity
gogoNP_649200.2 TSP1 459..505 CDD:214559 19/49 (39%)
CUB <570..640 CDD:294042 12/82 (15%)
AKAP2_C 1049..>1146 CDD:291950
thsd1XP_002936776.2 TSP1 343..392 CDD:214559 20/54 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.