DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clc and AT3G51890

DIOPT Version :9

Sequence 1:NP_001163480.1 Gene:Clc / 40221 FlyBaseID:FBgn0024814 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_566956.4 Gene:AT3G51890 / 824352 AraportID:AT3G51890 Length:258 Species:Arabidopsis thaliana


Alignment Length:233 Identity:60/233 - (25%)
Similarity:92/233 - (39%) Gaps:49/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LAREQSALGD--LEAEITGGSASAPPAAST-------DEGLGELLGGTASEGDLLSAGGTGGLES 75
            |:.|:|.|||  ...|:.||......|..:       |............|.||.....:...|:
plant     5 LSNEESGLGDSNRSTEVDGGDGGNFTAYESRFQSQRFDSSFSNFDSQPEKESDLPCGDSSPRPET 69

  Fly    76 ----STGSFEVIGGESNEPVGISGPPPSREEPEK---IRKWREEQKQRLEEKDIEEERKKEELRQ 133
                |..||:    ::|:.:   .||||..|.|:   :|:||.....|||||:.||:...:::.:
plant    70 QSPPSINSFD----DTNDSI---LPPPSAMEKEEGFALREWRRLNALRLEEKEKEEKEMVQQILE 127

  Fly   134 QSKKELDDWLRQIGESISKTKLASRNAEKQAATLENG----TIEPGTEWERIAKLCDFNPKV--- 191
            .:::...::..:...:|...|  ..|.||:...|||.    .......|:.||:|......|   
plant   128 AAEQYKAEFYSKRNVTIENNK--KLNREKEKFFLENQEKFYAEADKNNWKAIAELIPREVPVIEN 190

  Fly   192 ---------------NKAGK--DVSRMRSIYLHLKQNP 212
                           .|.||  |:||||.:...||.||
plant   191 RGNKKKTATITVIQGPKPGKPTDLSRMRQVLTKLKHNP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClcNP_001163480.1 Clathrin_lg_ch 6..212 CDD:279433 58/231 (25%)
AT3G51890NP_566956.4 Clathrin_lg_ch 5..225 CDD:279433 56/228 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10639
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
22.060

Return to query results.
Submit another query.