DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17147 and Mur89F

Sequence 1:NP_001262099.1 Gene:CG17147 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001262662.1 Gene:Mur89F FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster

Alignment Length:460 Identity:75/461 (16%)
Similarity:133/461 (29%) Gaps:169/461 (37%)


  Fly    38 GTKVRKPGTCDQYIQCYDGNGTVLTCPSNQSFNPSKGSCVDTLANSNKYCGN------------- 89
            |:...:..:.:|......|:.:.....|||..:.::||..:..::||:...|             
  Fly   943 GSSSNQGSSSNQGSSSNQGSSSNQGSSSNQGSSSNQGSSSNQSSSSNQSSSNQSSSNQSSSSNQT 1007

  Fly    90 -------------RCEGLDGEWVADPTECHKYFYCM-NG----VPLAGMCPVGQHFDERSQSCLY 136
                         :||. :..::||...|.|::.|: ||    ..::..||....:|..:.||.:
  Fly  1008 SSSTTQKPFKPAEKCES-EETFLADNENCSKFYRCVDNGKGGFTKVSFTCPPNTLWDPEANSCNH 1071

  Fly   137 GVDSMCVDVNNICELVAENTKFRN--EKDCAYYYECDKTGNHASKSCTVTSKKREYFDV------ 193
             .|.:........::|::.....|  ....:.......:.|..|.|.:.:|......:.      
  Fly  1072 -PDQIQTKPLKCKKVVSQGGSSSNSTSNSSSSSNNSGSSSNSGSSSSSSSSNSGSSSNTGSSSNS 1135

  Fly   194 ------------------------ESGNCVEANKVECTAHSKEN---------VCTSSTTMTFKS 225
                                    .|||...::....::.|..|         ..:||:|.:..:
  Fly  1136 GASSSGGSSNQGSSSNSGSSSGSNSSGNQSTSSSTSSSSSSSNNNNQGSSSSSSSSSSSTSSKPN 1200

  Fly   226 DQATCR--GYFV-----CKALYPVADLD-------PLWTQCPEGYFFDEDRQLC----------- 265
            ...||:  |.|:     |...|...|.|       |.  .|..|..:|...|.|           
  Fly  1201 PSETCKVNGQFIGDRSDCAKFYRCVDNDRGGFNMVPF--SCGPGTVWDAQMQACNHAWAVKECGG 1263

  Fly   266 -ANPTTVVCTHNR---------------------------------------------------- 277
             |.|||...|.:|                                                    
  Fly  1264 IAPPTTSTPTTSRPTTASTSRPSDQTSTSRPTGPPTTARPVTARPTTSSPTTASSSQTTSPVTQA 1328

  Fly   278 ------CDGRGTMLVTSSSNNCHNYIRCVDNKE----VTEETCHWDHFFDETVEACSSKIIYDKC 332
                  |...|.|   :..|||..:.|||.|.:    .....|.....:|:.::.|:..  ::.|
  Fly  1329 PNTDGKCRSEGFM---ADPNNCSKFYRCVRNNKGGFTSIPFQCGAGTVWDQDLQTCNHN--FNNC 1388

  Fly   333 CDGRD 337
            ..|.:
  Fly  1389 STGTE 1393

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 7/33 (21%)
ChtBD2 89..136 CDD:214696 15/78 (19%)
CBM_14 278..332 CDD:279884 13/58 (22%)
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884
CBM_14 200..250 CDD:279884
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884 13/50 (26%)
CBM_14 1206..1261 CDD:279884 12/57 (21%)
CBM_14 1336..1388 CDD:279884 12/57 (21%)
CBM_14 1523..1577 CDD:279884
VAD1-2 <1599..>1656 CDD:291956
CBM_14 1809..1861 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23301
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.