DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14185 and CG8800

Sequence 1:NP_649175.1 Gene:CG14185 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster

Alignment Length:201 Identity:51/202 (25%)
Similarity:86/202 (43%) Gaps:48/202 (24%)


  Fly   105 TLDELLRRVTQRTDLEAVEQVRLRVISYTVSLSRLSLFLPRLQSLDLSGSVLSSLRDLGYGLLQL 169
            |:.|.|:|..:|      ||..    |.|..:..|....|.::.:|   |.|.:       |:|.
  Fly     6 TIKEALKRWEER------EQQN----SLTAKVIDLQFQWPPIEKMD---STLGT-------LVQC 50

  Fly   170 TRLDISNCGLNSFDGTSGLPAIRVL---------------IADG--------NMIQRVDPLAELV 211
            .|:.:|...:....|.||:..::||               :|:.        |:|:::..|..|.
  Fly    51 ERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLK 115

  Fly   212 HLRVLKARNNRISELGLLSFLGMCPQLQEVELQGNPVCR---LPLYRSLLARSVPTLQLLDGR-- 271
            .|:||...||.|.:....:.|.....|:::.:.|||:..   .|.:|:...:.:||::.|||.  
  Fly   116 CLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLDGEPV 180

  Fly   272 VLNGEP 277
            |||.||
  Fly   181 VLNEEP 186

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 15/80 (19%)
leucine-rich repeat 146..168 CDD:275380 4/22 (18%)
LRR_4 168..209 CDD:289563 12/64 (19%)
leucine-rich repeat 169..190 CDD:275380 5/21 (24%)
leucine-rich repeat 191..212 CDD:275380 7/44 (16%)
leucine-rich repeat 213..237 CDD:275380 7/24 (29%)
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 45/190 (24%)
leucine-rich repeat 50..71 CDD:275380 5/21 (24%)
leucine-rich repeat 95..116 CDD:275380 4/21 (19%)
leucine-rich repeat 117..141 CDD:275380 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.