DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Grasp65 and gorasp1a

Sequence 1:NP_649160.1 Gene:Grasp65 FlyBaseID:FBgn0036919 Length:460 Species:Drosophila melanogaster
Sequence 2:XP_005171287.1 Gene:gorasp1a ZFINID:ZDB-GENE-030826-23 Length:461 Species:Danio rerio

Alignment Length:449 Identity:172/450 (38%)
Similarity:246/450 (55%) Gaps:83/450 (18%)


  Fly    10 PGGGTEGYHVLKVQDNSPGQKAGLEAFFDFIVAIAGTRLDQDNDMLKELLRQNVDKPVRLTVYSS 74
            |.||||||||..||::||.::||||.|||||::|...||:|:|||||:||:.||:|||::.|||:
Zfish    11 PEGGTEGYHVHGVQEDSPAERAGLEPFFDFIISIGHNRLNQENDMLKDLLKANVEKPVKMEVYST 75

  Fly    75 KTQTVRELTLTPSNNWGGQGLLGVSIRFCSFEGANESVWHILEVHPNSPAELAGLRAYSDYVIGA 139
            ||..:|||.:.|||.||||||||.|:|||||:||||:|||:|:|..||||.||||:.:||:::||
Zfish    76 KTMRMRELEVVPSNMWGGQGLLGASVRFCSFQGANENVWHVLDVESNSPAALAGLQEHSDFIVGA 140

  Fly   140 DAIRHENDDLFTLIETHEQQPLKMYVYNLDDDACREVTIKPNTAWGGEGALGCGIGFGYLHRIPV 204
            |.:..:::|.|:|||.||.:|||:.:||.:.|.||||.:.||.||||||:||||||:|||||||.
Zfish   141 DQVLQDSEDFFSLIEAHEGKPLKLLIYNTETDKCREVIVTPNGAWGGEGSLGCGIGYGYLHRIPA 205

  Fly   205 QAEPVTS---SSAAVPAAAAAESTAPL-------LTAGGAAPAGAQVAQVVSPTLPYIPPLANTF 259
            |.|...|   ||...|.|...|...|.       |.|.|.:.:|                     
Zfish   206 QPEGPKSEKVSSRESPVAGNPEQEYPTNGFSEVSLMASGQSLSG--------------------- 249

  Fly   260 GSTNAEVRPPTIEPPAQSLFKTYFNPDEATDALTAALESQAT-IAEPVSVPAPPAVADVSVAQPQ 323
                .::..| :.||.|.:    .:|..:..:..|.:.|:.: ||:.:.:    :.:.:.:....
Zfish   250 ----MDLETP-LPPPIQRV----MDPGFSDHSEVALMNSEVSDIADRLDL----STSSIDMTNTS 301

  Fly   324 VQVPAPAQPLPPPANIFIPGVFDPSTQQNANALGGIPAAQLPFPQATAAPAAVPMFSA---PQQA 385
            :.|...|.         :.||   ...|:::...|.|..|:     |...:||...|:   |..|
Zfish   302 LAVKEDAD---------VSGV---EELQDSDFHSGDPEEQI-----TEEYSAVDFSSSITPPSNA 349

  Fly   386 YMSAPAALSYPAGAQTVPSYPQVQPSMGGLFPTQPTPLPPQMAHVFAPPVPPQAGAAPA 444
              |.|.:||:    ..:|:            ||....:|..:|.:....:||...:.||
Zfish   350 --SPPLSLSH----SLLPN------------PTLENSVPTDVASLMNSSIPPLDSSIPA 390

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Grasp65NP_649160.1 PDZ <14..100 CDD:294084 55/86 (64%)
GRASP55_65 69..205 CDD:282364 85/136 (63%)
gorasp1aXP_005171287.1 PDZ <15..101 CDD:294084 55/86 (64%)
GRASP55_65 70..206 CDD:282364 85/136 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C12974219
eggNOG 1 0.900 E1_COG5233
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1366434at2759
OrthoFinder 1 1.000 FOG0001261
OrthoInspector 1 1.000 T597835
orthoMCL 1 0.900 OOG5_128083
Panther 1 1.100 O PTHR12893
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1703
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.740

Return to query results.
Submit another query.