DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Grasp65 and gorasp1

Sequence 1:NP_649160.1 Gene:Grasp65 FlyBaseID:FBgn0036919 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001004805.1 Gene:gorasp1 XenbaseID:XB-GENE-976361 Length:417 Species:Xenopus tropicalis

Alignment Length:482 Identity:184/483 (38%)
Similarity:252/483 (52%) Gaps:111/483 (23%)


  Fly     1 MGSSHSIHVP--GGGTEGYHVLKVQDNSPGQKAGLEAFFDFIVAIAGTRLDQDNDMLKELLRQNV 63
            ||.|.|:...  .||||||||..:|:|||.|.||||.|||||:||...||:::|.|.|:||:.|.
 Frog     1 MGLSMSLSSEPLEGGTEGYHVHGIQENSPAQSAGLEPFFDFIIAIGHARLNKENSMFKDLLKANA 65

  Fly    64 DKPVRLTVYSSKTQTVRELTLTPSNNWGGQGLLGVSIRFCSFEGANESVWHILEVHPNSPAELAG 128
            :|||:|.||::|:..|||:.:||||.||||||||.|:|||||:||||.|||:|:|.|||||.|||
 Frog    66 EKPVKLEVYNTKSMKVREVEVTPSNMWGGQGLLGASVRFCSFQGANEHVWHVLDVEPNSPAALAG 130

  Fly   129 LRAYSDYVIGADAIRHENDDLFTLIETHEQQPLKMYVYNLDDDACREVTIKPNTAWGGEGALGCG 193
            |::::||::|:|.|..|::|.:.|:|.||.:|||:.|||.:.|:||||.:.||:||||||:||||
 Frog   131 LQSHTDYIVGSDQILQESEDFYALVEAHEGKPLKLLVYNTETDSCREVFVTPNSAWGGEGSLGCG 195

  Fly   194 IGFGYLHRIPVQ-AEPVTSSSAAVPAAAAAESTAPLLTAGGAAPAGAQVAQVVSPTLPYIPPLAN 257
            ||:|||||||:: |.|:.::          |.|.|                  ||..|...||. 
 Frog   196 IGYGYLHRIPLKPASPIKNT----------EITPP------------------SPLTPKEEPLV- 231

  Fly   258 TFGSTNAEVRPPTIEPPAQSLFKTYFNPDEATDALTAALESQATIAEPVSVPAPPAVADVSVAQP 322
                           ||.....:|..   .|.|..|.|.|      |.:::|.         :..
 Frog   232 ---------------PPTNGYRETAL---MAGDGQTDATE------EAINLPG---------STE 263

  Fly   323 QVQVPAPAQP---LPPPA-NIFIPGVFDPSTQQNANALGGIPAAQLPFPQAT-------AAPAAV 376
            |:.:..||:.   ||||. .:..|||.|||    |.::..||..:.....|:       |.||..
 Frog   264 QMDLGNPAESSLVLPPPVQRVLHPGVLDPS----ALSMPEIPDIKQLIDMASPASMDLAAEPAGT 324

  Fly   377 PMFSAPQ--QAYMSAPAALSYPAGAQTVPSYPQVQPSMGGLFPTQPTPLP--------------- 424
            ..|...:  :|:| ...:.|..|....:.|:| .:.|:    |....|||               
 Frog   325 KQFIGAEELEAFM-GQVSFSEGAAVDNLASHP-AEDSL----PAPGNPLPPHWGLEEVTSEMTFE 383

  Fly   425 ----PQMAHVFAPP----VPPQAGAAP 443
                |.::...|||    .||:....|
 Frog   384 NEQSPDVSDAAAPPEGDLTPPEQLVTP 410

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Grasp65NP_649160.1 PDZ <14..100 CDD:294084 53/86 (62%)
GRASP55_65 69..205 CDD:282364 86/136 (63%)
gorasp1NP_001004805.1 PDZ 3..102 CDD:320768 57/99 (58%)
GRASP55_65 71..205 CDD:309581 85/134 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C12969671
eggNOG 1 0.900 E1_COG5233
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1366434at2759
OrthoFinder 1 1.000 FOG0001261
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.