DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grasp65 and gorasp2

DIOPT Version :8

Sequence 1:NP_649160.1 Gene:Grasp65 / 40177 FlyBaseID:FBgn0036919 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_956997.1 Gene:gorasp2 / 393676 ZFINID:ZDB-GENE-040426-1659 Length:434 Species:Danio rerio

Alignment Length:453 Identity:201/454 (44%)
Similarity:261/454 (57%) Gaps:56/454 (12%)


  Fly     1 MGSSHSIHVPGGGTEGYHVLKVQDNSPGQKAGLEAFFDFIVAIAGTRLDQDNDMLKELLRQNVDK 65
            ||.|.|:.:||||:||||||:||:||||.:||||.||||||:|..|||::|||.||::|:.:|:|
Zfish     1 MGGSQSVEIPGGGSEGYHVLRVQENSPGHRAGLEPFFDFIVSINNTRLNKDNDTLKDILKASVEK 65

  Fly    66 PVRLTVYSSKTQTVRELTLTPSNNWGGQGLLGVSIRFCSFEGANESVWHILEVHPNSPAELAGLR 130
            ||::.||||||..:||.|:||||.|||||||||||||||||||||:|||:|||.|||||.|||||
Zfish    66 PVKMQVYSSKTLELREATVTPSNMWGGQGLLGVSIRFCSFEGANENVWHVLEVEPNSPAALAGLR 130

  Fly   131 AYSDYVIGADAIRHENDDLFTLIETHEQQPLKMYVYNLDDDACREVTIKPNTAWGGEGALGCGIG 195
            .::||:||||.:.:|::|||:||||||.:.||:||||.|.|.||||.|.||:||||||:||||||
Zfish   131 PHTDYIIGADTVMNESEDLFSLIETHEGKGLKLYVYNTDTDNCREVVITPNSAWGGEGSLGCGIG 195

  Fly   196 FGYLHRIPVQAEPV-TSSSAAVPAAAAAESTAPLLTAGGAAPAGAQVAQVVSPTLPYIPPLANTF 259
            :|||||||.:  |. .....:.|....:|..:||..........|.....||..||  ..|.::.
Zfish   196 YGYLHRIPTR--PFEEGKKISFPGHTPSEPVSPLKDGFTEVQLSAVTPPPVSQPLP--TGLEDSL 256

  Fly   260 GSTNAEVRPPTIEPPAQSLFKTYFNPDEA-TDALTAALESQATIAEPVSVPAPPAVADVSVAQPQ 323
            ...:....||||             |.|. |...|..|         :.....|.:.::.:..|.
Zfish   257 SGLSLSSAPPTI-------------PSELHTGVPTVPL---------LPTHVTPGLGNLPLINPS 299

  Fly   324 ------VQVPAPAQPLPPPANI-FIPGVFDPSTQQNANALGGIPAAQLPFPQATAAPAAVPMFSA 381
                  :.:||...|||...|: .:|.:..|....:|.:|.||..    .|..||...::|..:.
Zfish   300 TNGPGLMSLPAGLPPLPNLPNLPNLPNLNLPLPDLSAVSLAGISG----LPPTTAGFPSLPPLNL 360

  Fly   382 PQQAYMSAPAALSYPAGAQTVPSYPQVQPSMGGLFPTQPTPLPPQMAHVFAPPVPPQAGAAPA 444
            |..:.:..|:.||     .|:||.|.|         |.|:||.|.   ...|||.......||
Zfish   361 PGISPLPMPSVLS-----STLPSMPGV---------TLPSPLAPS---DLVPPVSKATEQTPA 406

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Grasp65NP_649160.1 PDZ <14..100 CDD:294084 59/86 (69%)
GRASP55_65 69..205 CDD:282364 100/136 (74%)
gorasp2NP_956997.1 PDZ <14..100 CDD:294084 59/86 (69%)
GRASP55_65 69..205 CDD:282364 100/136 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C12977267
eggNOG 1 0.900 E1_COG5233
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1366434at2759
OrthoFinder 1 1.000 FOG0001261
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128083
Panther 1 1.100 LDO PTHR12893
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.710

Return to query results.
Submit another query.