DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Grasp65 and GORASP2

Sequence 1:NP_649160.1 Gene:Grasp65 FlyBaseID:FBgn0036919 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_056345.3 Gene:GORASP2 HGNCID:17500 Length:452 Species:Homo sapiens

Alignment Length:484 Identity:204/485 (42%)
Similarity:267/485 (55%) Gaps:117/485 (24%)


  Fly     1 MGSSHSIHVPGGGTEGYHVLKVQDNSPGQKAGLEAFFDFIVAIAGTRLDQDNDMLKELLRQNVDK 65
            ||||.|:.:|||||||||||:||:||||.:||||.||||||:|.|:||::|||.||:||:.||:|
Human     1 MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKDLLKANVEK 65

  Fly    66 PVRLTVYSSKTQTVRELTLTPSNNWGGQGLLGVSIRFCSFEGANESVWHILEVHPNSPAELAGLR 130
            ||::.:|||||..:||.::||||.||||||||||||||||:||||:|||:|||..||||.|||||
Human    66 PVKMLIYSSKTLELRETSVTPSNLWGGQGLLGVSIRFCSFDGANENVWHVLEVESNSPAALAGLR 130

  Fly   131 AYSDYVIGADAIRHENDDLFTLIETHEQQPLKMYVYNLDDDACREVTIKPNTAWGGEGALGCGIG 195
            .:|||:||||.:.:|::|||:||||||.:|||:||||.|.|.||||.|.||:||||||:||||||
Human   131 PHSDYIIGADTVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITPNSAWGGEGSLGCGIG 195

  Fly   196 FGYLHRIPVQAEPVTSSSAAVPAAAAAESTAPLLTAGGAAPAGAQVAQVVSPTLPYIPPLANTFG 260
            :|||||||.:           |.....:.:.|...||             :|    |.||.:.|.
Human   196 YGYLHRIPTR-----------PFEEGKKISLPGQMAG-------------TP----ITPLKDGFT 232

  Fly   261 STN-AEVRPPTIEPPAQSLFKTYFNPDEATDALTAALESQATIAEPVSVPA-PPAVADVSVAQPQ 323
            ... :.|.||::.||.                 |..:|...|   .:|:.: ||||:.|      
Human   233 EVQLSSVNPPSLSPPG-----------------TTGIEQSLT---GLSISSTPPAVSSV------ 271

  Fly   324 VQVPAPAQPLPPPANIFIPGVFDPSTQQNANALGGIPAAQLPFPQATAAPAAVPMFSAPQQAYMS 388
            :....|..||.||              |...:|..:|    |...||..|..:|:          
Human   272 LSTGVPTVPLLPP--------------QVNQSLTSVP----PMNPATTLPGLMPL---------- 308

  Fly   389 APAALSYPAGAQTVPSY------PQVQPSMG-------GLFP-----------TQPTPLPPQMAH 429
                   |||...:|:.      |.:.|.:|       ||.|           ..|.|||.:...
Human   309 -------PAGLPNLPNLNLNLPAPHIMPGVGLPELVNPGLPPLPSMPPRNLPGIAPLPLPSEFLP 366

  Fly   430 VFAPPVPPQAGAAPAAGNDELSGPAVNQA 458
            .|  |:.|::.:|.::|....|.|..:.|
Human   367 SF--PLVPESSSAASSGELLSSLPPTSNA 393

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Grasp65NP_649160.1 PDZ <14..100 CDD:294084 60/86 (70%)
GRASP55_65 69..205 CDD:282364 98/136 (72%)
GORASP2NP_056345.3 PDZ <14..100 CDD:320768 60/86 (70%)
GRASP. {ECO:0000255|PROSITE-ProRule:PRU01214} 15..215 137/211 (65%)
GRASP55_65 69..205 CDD:309581 98/136 (72%)
Important for membrane binding 194..199 4/5 (80%)
Atrophin-1 <241..397 CDD:331285 48/217 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C12979735
eggNOG 1 0.900 E1_COG5233
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 341 1.000 Inparanoid score I2325
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1366434at2759
OrthoFinder 1 1.000 FOG0001261
OrthoInspector 1 1.000 T1075011
orthoMCL 1 0.900 OOG5_128083
Panther 1 1.100 LDO PTHR12893
Phylome 1 0.910 0.714 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1703
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.