DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grasp65 and SPAC1D4.02c

DIOPT Version :8

Sequence 1:NP_649160.1 Gene:Grasp65 / 40177 FlyBaseID:FBgn0036919 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_593015.1 Gene:SPAC1D4.02c / 2542452 PomBaseID:SPAC1D4.02c Length:345 Species:Schizosaccharomyces pombe

Alignment Length:365 Identity:106/366 (29%)
Similarity:171/366 (47%) Gaps:63/366 (17%)


  Fly     7 IHVPGGGTEGYHVLKVQDNSPGQKAGLEAFFDFIVAIAGTRLDQDNDMLKELLRQNVDKPVRLTV 71
            ||.....:.|:.||||:::|....|.:|:::|||.|:.|..|:.|..|...|||.: ...|.|.|
pombe    19 IHRESDESCGFRVLKVENDSKAYNARIESYYDFITAVNGILLNGDPSMFMALLRDS-SPEVTLEV 82

  Fly    72 YSSKTQTVRELTLTPSNNWGGQGLLGVSIRFCSFEGANESVWHILEVHPNSPAELAGLRAYSDYV 136
            :|.|.|..|::.:..:::    ..:|:.:::.|...|.:::||||.|..:||...|.|..|.||:
pombe    83 FSLKGQITRKVNIKINSD----EKIGMVLQWASIAPAVDAIWHILNVIDDSPVARASLVPYEDYI 143

  Fly   137 IGA-DAIRHENDDLFTLIETHEQQPLKMYVYNLDDDACREVTIKPNTAWGGEGALGCGIGFGYLH 200
            :|. :.:......|..|||:|..:||::|:||...|:.|:|||.||..|||.||:|||:|.|.||
pombe   144 VGTPEGMMTGEKALSDLIESHLNRPLRLYIYNHYRDSTRQVTIVPNRHWGGNGAIGCGVGHGVLH 208

  Fly   201 RIPVQAEPVTSSSAAVPAAAAAESTAPLLTAGGAAPAGAQVAQVVS--PTLPYIPPLANTFGSTN 263
            |:|.   |:   |...|.......:.|:|  ||.....:|.::..:  || |..|.:|:....::
pombe   209 RLPA---PL---SGPPPQPGDIVFSNPML--GGPDHKVSQPSETENFLPT-PEPPKIASANAGSS 264

  Fly   264 AEVRPPTIEPPAQ--------SLFKTYFNPDE--------ATDALTAALESQATIAEPVSVPAPP 312
            .|:..|..:...:        |..::|.:.:|        .|...::..:||.|           
pombe   265 NEISIPHYQRHKKSHKGAIQDSSIQSYLDEEEKLSRELDHKTKDASSTNDSQTT----------- 318

  Fly   313 AVADVSVAQPQVQVPAPAQPLPPPANIFIPGVFDPSTQQN 352
                               |||||..:.:....|.|..||
pombe   319 -------------------PLPPPPPVAVNSTNDESAPQN 339

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Grasp65NP_649160.1 PDZ <14..100 CDD:294084 27/86 (31%)
GRASP55_65 69..205 CDD:282364 53/137 (39%)
SPAC1D4.02cNP_593015.1 GRH1 1..345 CDD:227558 106/366 (29%)
PDZ <19..82 CDD:294084 23/64 (36%)
GRASP55_65 80..213 CDD:282364 53/140 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I1340
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001261
OrthoInspector 1 1.000 T1125737
orthoMCL 1 0.900 OOG5_128083
Panther 1 1.100 LDO PTHR12893
Phylome 1 0.910 0.909 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1703
TreeFam 1 0.960
87.950

Return to query results.
Submit another query.