DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grasp65 and Y42H9AR.1

DIOPT Version :8

Sequence 1:NP_649160.1 Gene:Grasp65 / 40177 FlyBaseID:FBgn0036919 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_501354.1 Gene:Y42H9AR.1 / 177604 WormBaseID:WBGene00021536 Length:506 Species:Caenorhabditis elegans

Alignment Length:537 Identity:203/538 (38%)
Similarity:270/538 (50%) Gaps:130/538 (24%)


  Fly     1 MGSSHSIHVPGGGTEGYHVLKVQDNSPGQKAGLEAFFDFIVAIAGTRLDQDNDMLKELLRQNVDK 65
            ||||.|:.:|||||||||||:||:||||..||||.||||||:|...|||:|||.:||:|:|:::|
 Worm     1 MGSSESVPIPGGGTEGYHVLRVQENSPGAVAGLEPFFDFIVSIGNIRLDKDNDTMKEVLKQHIEK 65

  Fly    66 PVRLTVYSSKTQTVRELTLTPSNNWGGQGLLGVSIRFCSFEGANESVWHILEVHPNSPAELAGLR 130
            |:.:|||:||:|.||:.::.||.|||||||||||||||||:||::.||||:.|.|||||.||||.
 Worm    66 PLEITVYNSKSQAVRQTSIVPSQNWGGQGLLGVSIRFCSFDGASQHVWHIISVQPNSPASLAGLI 130

  Fly   131 AYSDYVIGADAIRHENDDLFTLIETHEQQPLKMYVYNLDDDACREVTIKPNTAWGGEGALGCGIG 195
            |.:||::||:::.|:.|||..|::.:|.:|||:||||:|.|..|||::.||:||||||.|||.||
 Worm   131 ADTDYILGAESVLHQADDLIALVQANEGKPLKLYVYNVDTDVVREVSLTPNSAWGGEGCLGCDIG 195

  Fly   196 FGYLHRIPVQAE---------------------PVTSSSAAVPAA------AAAESTAPLLTAGG 233
            :||||||||..:                     |:.......|||      :...||.||..|..
 Worm   196 YGYLHRIPVSVDRSKAVSQVSVAQIQPRVPVGNPLVDKVNKPPAATNFPDPSQFSSTVPLPPAPS 260

  Fly   234 A----APAGAQVAQVVSPTLPYIPPLA-----------NTFGSTNAE------------------ 265
            :    .|...|.|.:..|...|.||:|           |..|.::|:                  
 Worm   261 SLIQNLPPPPQPAFLPQPPTSYAPPVAATQQQPPVSESNGHGHSHADGGHGHSHDDGGHGHSHDG 325

  Fly   266 ----------------VRPPTIEPPAQSLFKTYFNPDEATDALTAALESQATIAEPVSVPAPPAV 314
                            |..||   |.|...::|.......|......:.||              
 Worm   326 GHGHSHEHSPSPAPAPVSSPT---PVQQYQQSYSQAQPPVDYYQQQQQQQA-------------- 373

  Fly   315 ADVSVAQPQVQVPAPAQPLPPPANIFIPGVFDPSTQQNANALGGIPAAQLPFP------QATAAP 373
                 .||.|..|...|...||    :|..:.|.....|:...|..|.....|      |::..|
 Worm   374 -----YQPPVNPPTSYQAYQPP----VPTSYYPPAASTASNSSGYQAPYYSPPSYPTQQQSSYVP 429

  Fly   374 AAV-PMFSA-----PQQAYMS---APAALSYPAGAQTVPSYPQV------QPSMGGLFPTQPTPL 423
            :|| |||||     |..:|::   .||.|::|     :||...:      .|.:.|....||...
 Worm   430 SAVPPMFSATSAPTPPTSYVNPIPPPAPLNFP-----MPSLSSIGITQLATPPVPGATSYQPPSF 489

  Fly   424 PPQMAHVFA--PPVPPQ 438
            |||....:.  ||.|||
 Worm   490 PPQQQQQYGAYPPAPPQ 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Grasp65NP_649160.1 PDZ <14..100 CDD:294084 57/86 (66%)
GRASP55_65 69..205 CDD:282364 87/136 (64%)
Y42H9AR.1NP_501354.1 PDZ <14..100 CDD:294084 57/86 (66%)
GRASP55_65 70..204 CDD:282364 86/134 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C12966070
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 323 1.000 Inparanoid score I1454
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1366434at2759
OrthoFinder 1 1.000 FOG0001261
OrthoInspector 1 1.000 T474291
orthoMCL 1 0.900 OOG5_128083
Panther 1 1.100 LDO PTHR12893
Phylome 1 0.910 0.917 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1703
TreeFam 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.