DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mtr3 and RRP41L

Sequence 1:NP_649157.1 Gene:Mtr3 FlyBaseID:FBgn0036916 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001320075.1 Gene:RRP41L AraportID:AT4G27490 Length:256 Species:Arabidopsis thaliana

Alignment Length:223 Identity:69/224 (31%)
Similarity:110/224 (49%) Gaps:19/224 (8%)


  Fly    48 RNTFIRAGVLTTVRGSAYMEYGNTKVLAIVAPPKELIRASARRMNMGVLNCYVNFAAFSTGDLDS 112
            |...::.|.:::..||||.|:|||||:..|..|:|..:|.. ..::|.|||.|::..|::..|..
plant    44 RPALLQTGAVSSASGSAYAEFGNTKVIVSVFGPRESKKAMV-YSDVGRLNCNVSYTNFASPTLGQ 107

  Fly   113 VPERERHLSSMLTKAMEPVVCRTEFLNFQLDIRVLILDDDGCLLSTAINCCGVALVECGISTYDL 177
            ..:.:.: ||||.||:|.|:....|....:|:..|:|:..|..||..|:|..:||.:.||..|||
plant   108 GTDHKEY-SSMLHKALEGVIMMETFPKTTVDVFALVLESGGSDLSVLISCASLALADAGIMMYDL 171

  Fly   178 ITA-STACIYRDHVFLNPSAKVEELLWKHRNSSTDSTTSPSSAQEHGLIITASMDTFEQIAQCQQ 241
            ||| |.:||.:. :.::|..:.|..    .:.|...|..||..:...|.||....|.......|.
plant   172 ITAVSVSCIGKS-LMIDPVTEEEGC----EDGSFMMTCMPSRYEITQLTITGEWTTPNINEAMQL 231

  Fly   242 CGYLSPATYVKLLDYTLAINKSLRELVK 269
            |           ||.:..:.:.:|:.:|
plant   232 C-----------LDASSKLGEIMRDCLK 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mtr3NP_649157.1 RNase_PH 47..274 CDD:295670 69/224 (31%)
RRP41LNP_001320075.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1101132at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11953
Phylome 1 0.910 0.923 Consistency score
33.020

Return to query results.
Submit another query.