DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtr3 and RRP41L

DIOPT Version :9

Sequence 1:NP_649157.1 Gene:Mtr3 / 40173 FlyBaseID:FBgn0036916 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001320075.1 Gene:RRP41L / 828858 AraportID:AT4G27490 Length:256 Species:Arabidopsis thaliana


Alignment Length:223 Identity:69/223 - (30%)
Similarity:110/223 - (49%) Gaps:19/223 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RNTFIRAGVLTTVRGSAYMEYGNTKVLAIVAPPKELIRASARRMNMGVLNCYVNFAAFSTGDLDS 112
            |...::.|.:::..||||.|:|||||:..|..|:|..:|.. ..::|.|||.|::..|::..|..
plant    44 RPALLQTGAVSSASGSAYAEFGNTKVIVSVFGPRESKKAMV-YSDVGRLNCNVSYTNFASPTLGQ 107

  Fly   113 VPERERHLSSMLTKAMEPVVCRTEFLNFQLDIRVLILDDDGCLLSTAINCCGVALVECGISTYDL 177
            ..:.:.: ||||.||:|.|:....|....:|:..|:|:..|..||..|:|..:||.:.||..|||
plant   108 GTDHKEY-SSMLHKALEGVIMMETFPKTTVDVFALVLESGGSDLSVLISCASLALADAGIMMYDL 171

  Fly   178 ITA-STACIYRDHVFLNPSAKVEELLWKHRNSSTDSTTSPSSAQEHGLIITASMDTFEQIAQCQQ 241
            ||| |.:||.:. :.::|..:.|..    .:.|...|..||..:...|.||....|.......|.
plant   172 ITAVSVSCIGKS-LMIDPVTEEEGC----EDGSFMMTCMPSRYEITQLTITGEWTTPNINEAMQL 231

  Fly   242 CGYLSPATYVKLLDYTLAINKSLRELVK 269
            |           ||.:..:.:.:|:.:|
plant   232 C-----------LDASSKLGEIMRDCLK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mtr3NP_649157.1 RNase_PH 47..274 CDD:295670 69/223 (31%)
RRP41LNP_001320075.1 RNase_PH_MTR3 43..249 CDD:206776 69/223 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3173
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 1 1.010 - - D1101132at2759
OrthoFinder 1 1.000 - - FOG0001991
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102545
Panther 1 1.100 - - LDO PTHR11953
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4850
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.