DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mtr3 and RRP41

Sequence 1:NP_649157.1 Gene:Mtr3 FlyBaseID:FBgn0036916 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001118878.1 Gene:RRP41 AraportID:AT3G61620 Length:241 Species:Arabidopsis thaliana

Alignment Length:250 Identity:68/250 (27%)
Similarity:106/250 (42%) Gaps:37/250 (15%)


  Fly    48 RNTFIRAGVLTTVRGSAYMEYGNTKVLAIVAPPKELIRASARRMN-MGVLNCYVNFAAFSTGD-- 109
            |......||::...|||..|.|||||:|.|..|:|:...|.::.| ..|:.|..:.|.|||||  
plant    20 RQIVAEVGVVSKADGSAVFEMGNTKVIAAVYGPREIQNKSQQKKNDHAVVLCEYSMAQFSTGDRR 84

  Fly   110 LDSVPERERHLSSMLTKAMEPVVCRTEFLNFQLDIRVLILDDDGCLLSTAINCCGVALVECGIST 174
            ......|...||.::.:.||..:......:.|:||.:.:|..||...|..||...:||.:.||..
plant    85 RQKFDRRSTELSLVIRQTMEACILTELMPHSQIDIFLQVLQADGGTRSACINAATLALADAGIPM 149

  Fly   175 YDLITASTACIYRDHVFLNPSAKVEELLWKHRNSSTDSTTS--PSSAQEHGLIITAS--MDTFEQ 235
            .||..:.:|      .:||.:..::....:......|.|..  |...:...|.:.|.  |:|||.
plant   150 RDLAVSCSA------GYLNSTPLLDLNYVEDSAGGADVTVGILPKLDKVSLLQMDAKLPMETFET 208

  Fly   236 IAQCQQCGYLSPATYVKLLDYTLAIN--KSLRELVKGVLTKRVKEQHELDLREKA 288
            :                   :.||..  |::.|.::.||.:..|   :|:.|..|
plant   209 V-------------------FALASEGCKAIAERIREVLQENTK---QLEYRRAA 241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mtr3NP_649157.1 RNase_PH 47..274 CDD:295670 64/235 (27%)
RRP41NP_001118878.1 PRK03983 7..230 CDD:235187 64/235 (27%)
RNase_PH_RRP41 8..233 CDD:206775 64/238 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.