DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mtr3 and Exosc6

Sequence 1:NP_649157.1 Gene:Mtr3 FlyBaseID:FBgn0036916 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_082550.1 Gene:Exosc6 MGIID:1919794 Length:273 Species:Mus musculus

Alignment Length:233 Identity:69/234 (29%)
Similarity:102/234 (44%) Gaps:39/234 (17%)


  Fly    25 PQESE--DFFESLD---KPSREPTQLAPRNTFIRAGVLTTVRGSAYMEYGNTKVLAIVAPPKEL- 83
            |:||:  ..:.:.|   ..:|:||:|.|  .:.|||:|:..:||||:|.|.||||..|:.|::. 
Mouse    11 PEESQPPQLYAAEDDETPAARDPTRLRP--VYARAGLLSQAKGSAYLEAGGTKVLCAVSGPRQAE 73

  Fly    84 ----------IRASARRMNMGVLNCYVNFAAFSTGDLDSVPE----RERHLSSMLTKAMEPVVCR 134
                      ....|.....|.|.|....|.|| |.....|:    .:|.|...|.:|:||.|..
Mouse    74 GGERGSGPAGAGGEAPAALRGRLLCDFRRAPFS-GRRRRAPQGGGGEDRELGLALQEALEPAVRL 137

  Fly   135 TEFLNFQLDIRVLILDDDGCLLSTAINCCGVALVECGISTYDLITASTACIYRDHVFLNPSAKVE 199
            ..:...||::..|:|:|.||.|:.|:....:||.:.|:..|||:   ..|    .:.|.|.....
Mouse   138 GRYPRAQLEVSALLLEDGGCALAAALTAAALALADAGVEMYDLV---VGC----GLSLTPGPSPT 195

  Fly   200 ELLWKHRNSSTDSTTSPSSAQEHGLIITASMDTFEQIA 237
            .||        |.|.........||.: |.|....|:|
Mouse   196 WLL--------DPTRLEEEHSAAGLTV-ALMPVLNQVA 224

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mtr3NP_649157.1 RNase_PH 47..274 CDD:295670 61/207 (29%)
Exosc6NP_082550.1 Rph 28..260 CDD:223761 65/217 (30%)
RNase_PH_MTR3 36..261 CDD:206776 62/209 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C27613726
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128529
Panther 1 1.100 LDO PTHR11953
Phylome 1 0.910 0.850 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R763
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.