DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mtr3 and exosc6

Sequence 1:NP_649157.1 Gene:Mtr3 FlyBaseID:FBgn0036916 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001017016.1 Gene:exosc6 XenbaseID:XB-GENE-998313 Length:270 Species:Xenopus tropicalis

Alignment Length:249 Identity:72/250 (29%)
Similarity:117/250 (47%) Gaps:32/250 (13%)


  Fly    28 SEDFFESLDKPSREPTQLAPRNTFIRAGVLTTVRGSAYMEYGN--TKVLAIVAPPKELIRASARR 90
            ||:..::..:..|.|::  ||..|:|||:|:..:||||:|.|:  ||||..|..|:|......|.
 Frog    23 SEEGGKAAGRRGRGPSE--PRPVFVRAGLLSQAKGSAYLEAGSGGTKVLCAVHGPRERGMGGERA 85

  Fly    91 MNMGVLNCYVNFAAFS-----TGDLDSVPERERHLSSMLTKAMEPVVCRTEFLNFQLDIRVLILD 150
            ...|.|.|.:.:|.||     :|...:.|. .|.....|.:::||.|....:...::.:.||:|:
 Frog    86 ETRGRLLCDLRWAPFSRRGPWSGSCPAGPS-PRQAGLQLQESLEPAVRLDRYPRAEVIVWVLVLE 149

  Fly   151 DDGCLLSTAINCCGVALVECGISTYDLITASTAC-IYR---DHVFLNPSAKVEELLWKHRNSSTD 211
            |.|..|..|::|..:||.:.||..:||   :..| :.|   ..:.|:|....||       :.:.
 Frog   150 DRGSALPAAVSCASLALADAGIEMFDL---ALGCGLSRGPGGELLLDPDDDEEE-------AGSG 204

  Fly   212 STTS----PSSAQEHGLIITASMD---TFEQIAQCQQ-CGYLSPATYVKLLDYT 257
            .|.|    |:..|..|||.:...:   :.|.:..|.: |..|.|..:..|:..|
 Frog   205 GTMSLSLLPTLNQVSGLISSGEWEGESSEEAVRLCMEGCQRLYPVLHQCLVKAT 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mtr3NP_649157.1 RNase_PH 47..274 CDD:295670 68/231 (29%)
exosc6NP_001017016.1 RNase_PH_MTR3 40..256 CDD:206776 67/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C27614375
eggNOG 1 0.900 E1_COG0689
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1101132at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.833 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R763
TreeFam 1 0.960
76.740

Return to query results.
Submit another query.