DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mtr3 and exosc6

Sequence 1:NP_649157.1 Gene:Mtr3 FlyBaseID:FBgn0036916 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001018322.1 Gene:exosc6 ZFINID:ZDB-GENE-050522-362 Length:271 Species:Danio rerio

Alignment Length:283 Identity:75/284 (26%)
Similarity:118/284 (42%) Gaps:56/284 (20%)


  Fly    25 PQESED--FFESLDKPSREPTQLA-------PRNTFIRAGVLTTVRGSAYMEYGNTKVLAIVAPP 80
            |:||:.  .|.|.||..:.|:...       .|..|.|.|:::..:||||:|.||||::..|..|
Zfish    11 PEESQSPLLFLSPDKAPKAPSSRQGVRGNGDVRPVFARCGLVSQAKGSAYIEAGNTKIICSVYGP 75

  Fly    81 KELIRASARRMNMGVLNCYVNFAAFS--------TGDLDSVPERERHLSSMLTKAMEPVVCRTEF 137
            ||..|.....|..|.|.|....|.||        .|      ..||.||:.|.:::.|.||...:
Zfish    76 KETERRDETDMKTGRLVCDFRLAPFSCVKRGAWIQG------SEERDLSATLMESLRPGVCLHRY 134

  Fly   138 LNFQLDIRVLILDDDGCLLSTAINCCGVALVECGISTYDLITASTACIYRDHVFLNPSAKVEELL 202
            ...|:|:.|::|::||.:|:.|:.|..:||.:.||..||::...|.                   
Zfish   135 PRSQIDVNVMVLENDGSVLAHAVTCASMALADAGIEMYDIVLGCTL------------------- 180

  Fly   203 WKHRNSSTDSTTSPSSAQE-----------HGLIITASMDTFEQIAQCQQCGYLSPATYVKLLDY 256
               |.|.......||.|:|           .|.:..|.:....|::.....|.:...|..:.:..
Zfish   181 ---RQSGNACLVDPSYAEECGSWQEGYGDNQGCVTLALLPNLNQVSGLNADGEMREDTLTEAMRT 242

  Fly   257 TLAINKSLRELVKGVLTKRVKEQ 279
            .:.....|..:|:..||:.||::
Zfish   243 CMDGCHKLYPVVQQALTRAVKKK 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mtr3NP_649157.1 RNase_PH 47..274 CDD:295670 65/246 (26%)
exosc6NP_001018322.1 ECX1 30..258 CDD:131120 64/256 (25%)
RNase_PH_MTR3 42..258 CDD:206776 63/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C27614590
eggNOG 1 0.900 E1_COG0689
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1101132at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128529
Panther 1 1.100 LDO PTHR11953
Phylome 1 0.910 0.906 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R763
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.740

Return to query results.
Submit another query.