DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mtr3 and exosc5

Sequence 1:NP_649157.1 Gene:Mtr3 FlyBaseID:FBgn0036916 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_002939437.3 Gene:exosc5 XenbaseID:XB-GENE-6257997 Length:215 Species:Xenopus tropicalis

Alignment Length:188 Identity:42/189 (22%)
Similarity:81/189 (43%) Gaps:16/189 (8%)


  Fly    56 VLTTVRGSAYMEYGNTKVLAIVAPPKELIRASARRMNMGVLNCYVNFAAFSTGDLDSVPERERHL 120
            :|:...|||....|:|.|:|.|..|.| |:.|....|...|...:.   ..|| |.::  :|::.
 Frog    17 LLSRPDGSATFLQGDTSVMAGVYGPAE-IKVSREIHNKATLEVILR---PKTG-LPAI--QEKNQ 74

  Fly   121 SSMLTKAMEPVVCRTEFLNFQLDIRVLILDDDGCLLSTAINCCGVALVECGISTYDLITASTACI 185
            ..::.:..|.|:..:......:.|.:.|:.|.|.|||..:|...:.|::.|:....|....|..:
 Frog    75 EQLIRETCESVIIGSLHPRTSITIVLQIVSDAGSLLSCCLNAACMGLMDAGLPMRALFCGVTCAM 139

  Fly   186 YRD-HVFLNPSAKVEELLWKHRNSSTDSTTSPSSAQEHGLIITASMDTFEQIAQCQQC 242
            ..| .:.|:|:       ::.:..|....|....:.|..:::.::...: ...:.|||
 Frog   140 DNDGTITLDPN-------FRQQKESRAVLTFAIESTERKVLMMSNRGVY-SATELQQC 189

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mtr3NP_649157.1 RNase_PH 47..274 CDD:295670 42/189 (22%)
exosc5XP_002939437.3 Rph 8..209 CDD:223761 42/189 (22%)
RNase_PH_RRP46 8..205 CDD:206777 42/189 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.