DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(Tpl) and marveld2b

DIOPT Version :10

Sequence 1:NP_649155.3 Gene:Su(Tpl) / 40171 FlyBaseID:FBgn0014037 Length:1059 Species:Drosophila melanogaster
Sequence 2:NP_001119878.1 Gene:marveld2b / 563122 ZFINID:ZDB-GENE-050208-54 Length:572 Species:Danio rerio


Alignment Length:108 Identity:38/108 - (35%)
Similarity:60/108 - (55%) Gaps:1/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   831 SQYVPIQTLEVRRRYKTEFESDYDEYRKLLTRVEDVRNRFQDLSERLESARRCDNGYGDYDHIKR 895
            ::|..|:|.|.|.|||..|...|.||::|...|:.:..:|:::...:.:..:..:...:.:.|. 
Zfish   459 AKYPTIRTDEERERYKAVFNDQYAEYKELHAEVQVLTQKFEEMDNLMRNLPQRPSSQMEQERIS- 522

  Fly   896 QIVCEYERINNDRTIGEDKERFDYLHAKLAHIKQLVMDYDKTL 938
            .||.||.|...|.|..|.:||.:||..|||||||.:.:|||.:
Zfish   523 SIVQEYNRKKADPTYQEKRERCEYLKNKLAHIKQKIQEYDKIM 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(Tpl)NP_649155.3 ELL 16..462 CDD:463068
Occludin_ELL 833..936 CDD:462140 36/102 (35%)
marveld2bNP_001119878.1 MARVEL 194..371 CDD:366555
Occludin_ELL 461..563 CDD:462140 36/102 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.