DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RABG3B

DIOPT Version :10

Sequence 1:NP_524172.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_173688.1 Gene:RABG3B / 838880 AraportID:AT1G22740 Length:203 Species:Arabidopsis thaliana


Alignment Length:52 Identity:11/52 - (21%)
Similarity:19/52 - (36%) Gaps:5/52 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LGKLSGDCETVTPEECQRLFGVEEEEEEEKEMENVKEGSAAFL----IALEN 156
            :..|..|...:...|...........::.|..| :|:.||..|    |.::|
plant     1 MATLDSDVTMIPAGEASSSVAASSSNKKAKRFE-IKKWSAVALWAWDIVVDN 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_524172.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 11/52 (21%)
RABG3BNP_173688.1 Rab7 9..180 CDD:206655 9/44 (20%)

Return to query results.
Submit another query.