DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RABA1f

DIOPT Version :10

Sequence 1:NP_524172.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_200894.1 Gene:RABA1f / 836207 AraportID:AT5G60860 Length:217 Species:Arabidopsis thaliana


Alignment Length:180 Identity:85/180 - (47%)
Similarity:124/180 - (68%) Gaps:1/180 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQER 69
            ||||||::|||||||||:.:|.||:.:.|:....||||::|..|:|.:|:|.:|.||||||||||
plant    10 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQIWDTAGQER 74

  Fly    70 FRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKE 134
            :|.||:||||||:|.:||||:|:..:|||::.|::.:.::..|::..|.:|||.:|...|.||.|
plant    75 YRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDANIVIMFVGNKADLRHLRAVSTE 139

  Fly   135 RGEQLAIEYGIKFMETSAKASINVEEAFLTLASDI-KAKTEKRMEANNPP 183
            ..:..|......||||||..|:|||.||..:.|.| :..:.|.::..:.|
plant   140 DAKAFAERENTFFMETSALESMNVENAFTEVLSQIYRVVSRKALDIGDDP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_524172.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 82/166 (49%)
RABA1fNP_200894.1 Rab11_like 11..175 CDD:206660 81/163 (50%)

Return to query results.
Submit another query.