DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RAB17

DIOPT Version :10

Sequence 1:NP_524172.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_016860182.1 Gene:RAB17 / 64284 HGNCID:16523 Length:338 Species:Homo sapiens


Alignment Length:144 Identity:35/144 - (24%)
Similarity:51/144 - (35%) Gaps:30/144 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 NSADIKAKLGKLSGDCETVTPEECQ----------RLFGVEEEEEEEKEMENVKEGSAAFLIALE 155
            |:|.||..:|:.....|..:|:|.|          .|||..........|:.:   |...|:.|.
Human  2711 NTASIKNLMGQELRRLEGHSPQEAQISFIEAMSQLPLFGYTVYGVLRVSMQAL---SGPTLLGLN 2772

  Fly   156 NKRAIKVLGKSMVVGLGITFFAGLSFSLFSPL-----------FNLATNDQ--WHTLKQGVPKLI 207
            .:..|.:...|..:...|...:.....|.|||           :..|.|.|  |..|.|.  :.:
Human  2773 RQHLILMDPSSQSLYCRIALKSLQRLHLLSPLEEKGPPGLEVNYGSADNPQTIWFELPQA--QEL 2835

  Fly   208 VYTAFFYF--SLSC 219
            :||..|..  |.||
Human  2836 LYTTVFLIDSSASC 2849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_524172.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 18/80 (23%)
RAB17XP_016860182.1 P-loop containing Nucleoside Triphosphate Hydrolases 20..>146 CDD:476819
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.