DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and Rab44

DIOPT Version :10

Sequence 1:NP_524172.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001418712.1 Gene:Rab44 / 309649 RGDID:1560150 Length:970 Species:Rattus norvegicus


Alignment Length:186 Identity:72/186 - (38%)
Similarity:113/186 - (60%) Gaps:8/186 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERF 70
            |||:.::.:|||.||||..|.....|:|.....:|:|:||:::.:.:|||...||:||||||||:
  Rat   780 DYLYHVIFLGDSNVGKTSFLHLLHHDSFAAGLTATVGVDFRVKNLLVDNKTFALQLWDTAGQERY 844

  Fly    71 RTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKER 135
            .::|....|.|.|::|:||:|.::||.:::.|:..:::.....|..:|||||.:..::|||..|.
  Rat   845 HSLTRQLLRKAEGVVLMYDVTSQESFTHVRYWLDCLQDAGVEGVAMVLLGNKTDCEEERQVPTEA 909

  Fly   136 GEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEAN-------NPPK 184
            |.:||.|.||.|.|.||....|:.|..:.||..:|.: |.|.:|:       .|||
  Rat   910 GRRLAQELGISFGECSAALGHNILEPMMNLARSLKMQ-EDRQKASLVEVTRQEPPK 964

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_524172.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 66/165 (40%)
Rab44NP_001418712.1 EF-hand_7 45..101 CDD:463900
Smc <161..>326 CDD:440809
Rab 785..941 CDD:206640 61/155 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.