DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RAB38

DIOPT Version :10

Sequence 1:NP_524172.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_071732.1 Gene:RAB38 / 23682 HGNCID:9776 Length:211 Species:Homo sapiens


Alignment Length:53 Identity:17/53 - (32%)
Similarity:20/53 - (37%) Gaps:7/53 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 VHSSNSADIKAKLGKLSGDC---ETVT----PEECQRLFGVEEEEEEEKEMEN 142
            :...||.|....||..|...   ||||    ..|....:..||.:.|..|.||
Human    56 IKRENSRDAALGLGPKSQKPPAEETVTALLGQNEVPMSWKPEEAKTEVWESEN 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_524172.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 17/53 (32%)
RAB38NP_071732.1 Rab32_Rab38 10..208 CDD:206692 17/53 (32%)
Switch 1. /evidence=ECO:0000250|UniProtKB:Q13637 32..46
Switch 2. /evidence=ECO:0000250|UniProtKB:Q13637 68..81 4/12 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.