DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Deaf1 and gmeb1

DIOPT Version :8

Sequence 1:NP_001262069.1 Gene:Deaf1 / 40164 FlyBaseID:FBgn0013799 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001072432.1 Gene:gmeb1 / 779886 XenbaseID:XB-GENE-1002169 Length:503 Species:Xenopus tropicalis

Alignment Length:483 Identity:97/484 (20%)
Similarity:165/484 (34%) Gaps:158/484 (33%)


  Fly    81 VVSVPVSLPIGSMITGTTFNVITPDQLPPHFKPMLCVDNNGYLSGSTVSMGNDLKTIVIQQQQTQ 145
            :.:..|::|:|.::      ||..|          |.:...         ..|.||.||.|.|..
 Frog     1 MANAEVTVPMGDVV------VIPSD----------CTEGED---------PEDTKTQVILQLQPI 40

  Fly   146 PGGGGGGANNAGTNTTA------TNTIGLNHDGSGSNNSHDSLATLEHAAGGASGVGGGGGGTGG 204
            |.|..|..    |:|:|      |:|:.:.          |:|                .|||  
 Frog    41 PHGIYGDM----TDTSAAVVSLETHTLKMG----------DTL----------------DGGT-- 73

  Fly   205 GSSGWSENPSTQHNEVFQIRCKTTCAE-----LYRSKLGSGGRGRCVKYKDKWHTPSEFEHVCGR 264
                      .:.:|...|....||.|     |::..:..|...:|||:.|:..:|..|.|:.|:
 Frog    74 ----------VELSEDIDIAYPITCGESKAVLLWKKFVCPGINVKCVKFNDQLISPKHFVHLAGK 128

  Fly   265 GSSKDWKRSIKYGGKSLQSLIDEGTLTPHATNCSCTVCCD----DEAGESASGPVR-----LFTP 320
            .:.|||||:|:.||..|:.::|.|.:..:..:..||..|.    |....||..||.     :.||
 Frog   129 STLKDWKRAIRLGGTMLRKMMDTGQIDFYQHDRVCTNTCRSTKFDLLINSARAPVPGQGTIVQTP 193

  Fly   321 YKRRKRNQTDLDMESGPKRKRNTHHSNNNNSNTNNNNTSGSGANNCV-DVTAAVAAATASVVDEN 384
                                          |.|..:.:|.:.:...| |.|........:.:..|
 Frog   194 ------------------------------STTEGSLSSVTVSEQMVEDTTVEWGTGLTATLQMN 228

  Fly   385 NMFLSEENITSKDEP--------WAALNDSLDTSTELVD-------------QSQMGN-TYERET 427
            .    ||....:.|.        |..::| :....|:::             |.:.|. .::...
 Frog   229 R----EERTKKEGEEISEETLLFWKGISD-VGLMDEVINKIHNEIEELLSGVQQRAGQIPFQVSD 288

  Fly   428 FVVNINDGSSIAVLDT---------SQSMKNIEHVYCTMVKATNDFKRMLNDMKQSFERRIEVLQ 483
            ..|..|...|..:||:         ||:..:.|..:.|:.    :.:|.|.:.|:....:..:||
 Frog   289 ATVLSNVAHSFGLLDSVKKVLEQKKSQTEHSEEQYHYTLA----ELERQLEEQKKQEGSKSPLLQ 349

  Fly   484 KERDAAVSAMRVQVHADIDDPNISGSLH 511
            ......:|..:......:..|..:|||:
 Frog   350 NVVLMPMSTPKPPKRPRLQRPASAGSLN 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Deaf1NP_001262069.1 SAND 219..291 CDD:128554 26/77 (34%)
zf-MYND 521..557 CDD:280009
gmeb1NP_001072432.1 SAND 81..154 CDD:307487 25/73 (34%)
DMAP_binding 327..400 CDD:283995 10/56 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.