DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Deaf1 and si:ch73-302a13.2

DIOPT Version :8

Sequence 1:NP_001262069.1 Gene:Deaf1 / 40164 FlyBaseID:FBgn0013799 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_009295385.1 Gene:si:ch73-302a13.2 / 568906 ZFINID:ZDB-GENE-090313-149 Length:501 Species:Danio rerio

Alignment Length:290 Identity:57/291 (20%)
Similarity:116/291 (40%) Gaps:59/291 (20%)


  Fly   210 SENPSTQHNEVFQIRCKTTCAELYRSKLGSGGRG-RCVKYKDKWHTPSEFEHVCGRGSSKDWKRS 273
            |::...:.:.::.|.|..:.|.|...|....|.. :||:..:...:|.||.::.|:.:.|||||:
Zfish    75 SDDTDVEGDILYPITCGDSKANLVWKKFVCPGINIKCVQLNEHLISPKEFVYIAGKSTLKDWKRA 139

  Fly   274 IKYGGKSLQSLIDEGTLT--PHATNCSCTVCCDDEAGESASGPVRLFTPYKRRKRNQTDLDM--- 333
            |:..|..|:.::|.|.|.  .|:..||.|  |                       ..|.:|:   
Zfish   140 IRLNGTMLRKIMDSGELDFYQHSRLCSNT--C-----------------------RSTKIDLVGS 179

  Fly   334 ESGPKRKRNTHHSNNNNSNTNNNNTSGSGANNCVDVTAAVAAATASVVDENNMFLSEENITSKDE 398
            ......:::|..:....::|:.|.:|.|.:.:..|.|..|.|            :.|:.:|.   
Zfish   180 RGSLSSQQSTETAPATPASTDVNGSSSSFSTDVEDSTEWVTA------------IGEDTMTF--- 229

  Fly   399 PWAALNDS---LDTSTELVDQSQ--MGNTYER-ETFVVNINDGSSIAVLDTSQSMKNIEHVYCTM 457
             |..|.|:   .|...:|..:.|  :....|| :...:.:.|.:.:..:..:..|.::      :
Zfish   230 -WRGLKDAGMLEDVMEDLQKEIQEILKGLEERIQDPPLQVKDAALLNNIVQNFGMLDL------V 287

  Fly   458 VKATNDFKRMLNDMKQSFERRIEVLQKERD 487
            .|.....|..::..::.:.|.:..|:::.|
Zfish   288 KKVLASHKSQMDRCREQYTRSLVALEQQCD 317

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Deaf1NP_001262069.1 SAND 219..291 CDD:128554 23/73 (32%)
zf-MYND 521..557 CDD:280009
si:ch73-302a13.2XP_009295385.1 SAND 81..156 CDD:279658 22/75 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.