DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Deaf1 and gmeb1

DIOPT Version :8

Sequence 1:NP_001262069.1 Gene:Deaf1 / 40164 FlyBaseID:FBgn0013799 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_021323796.1 Gene:gmeb1 / 567701 ZFINID:ZDB-GENE-060503-35 Length:590 Species:Danio rerio

Alignment Length:416 Identity:87/417 (21%)
Similarity:137/417 (33%) Gaps:152/417 (36%)


  Fly   128 VSMGNDLKTIVIQQQQTQPGGGGGGANNAGTNTTATNTIGLNHDGSGSNNSHDSLATLEHAAGGA 192
            |...|..||.:|.|.|....|.|..:|.......|.                             
Zfish    24 VEPDNQSKTQMILQLQPMTAGLGDESNETDAAVVAV----------------------------- 59

  Fly   193 SGVGGGGGGTGGGSSGWSENPSTQHNEVFQIRCKTTCAE-----LYRSKLGSGGRGRCVKYKDKW 252
                              |:..:...|..::....||.|     |::..:..|...|||||:|:.
Zfish    60 ------------------EDEVSAEGEDLELGYPITCGESKAILLFKKFVCPGINVRCVKYEDQL 106

  Fly   253 HTPSEFEHVCGRGSSKDWKRSIKYGGKSLQSLIDEGTLTPHATNCSCTVCCDDEAGESASGPVRL 317
            .:|.:|.|:.|:.:.|||||:|:.||..|:.::|.|.|..:..:..||..|              
Zfish   107 ISPKQFVHMSGKATLKDWKRAIRMGGVMLRKMMDSGQLDFYQHSTLCTNTC-------------- 157

  Fly   318 FTPYKRRKRNQTDLDMESGPKRKRNTHHSNNNNSNTNNNNT----SGSGANNCVDVTAAVAAATA 378
                     ..|..|:..                    |||    .|||.|  ..:|||.....|
Zfish   158 ---------RSTKFDLLI--------------------NNTRFPPDGSGLN--TPITAAEYVFPA 191

  Fly   379 SVVDENNMFLSEENITSKDEPWAALNDSLDTSTELVDQSQMGNTYERETF-------------VV 430
            ..|...|...:......|::...|:..|.|||.:. |.|::..  |..:|             |.
Zfish   192 GHVTVGNGGQAATVEEKKEDVIGAVEWSPDTSDKR-DTSEISE--ETLSFWRGIAEVGLMGEVVS 253

  Fly   431 NI--------------NDGSS-----IAVLDTSQSMKNIEHVYCTM--VKATNDFKRMLNDMKQ- 473
            ||              .|.||     ||||      .|:..|:..:  :|...:.:|.:.|.:| 
Zfish   254 NIRSELLGLLRGVQLRTDQSSLQDAEIAVL------SNLAQVFNLLDSIKQILNVRRQMTDPEQT 312

  Fly   474 -------SFERRIEVLQKERDAAVSA 492
                   :.|:::|..:.::..:.|:
Zfish   313 QVLRTLTTLEQQLEEQKMQQSLSWSS 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Deaf1NP_001262069.1 SAND 219..291 CDD:128554 28/77 (36%)
zf-MYND 521..557 CDD:280009
gmeb1XP_021323796.1 SAND 74..144 CDD:307487 26/70 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.