DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Deaf1 and deaf1

DIOPT Version :8

Sequence 1:NP_001262069.1 Gene:Deaf1 / 40164 FlyBaseID:FBgn0013799 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_005174312.1 Gene:deaf1 / 563776 ZFINID:ZDB-GENE-081022-163 Length:532 Species:Danio rerio

Alignment Length:559 Identity:155/560 (28%)
Similarity:231/560 (41%) Gaps:157/560 (28%)


  Fly    77 GGGGVVSVPVSLP----------------IGSMITGT----TFNVITPDQLPPHFKPMLCVDNNG 121
            |..|.:.:..|||                :|.:.:..    |..|.|...:|.|           
Zfish    44 GEAGTIDITESLPNPDDAETAFAEVTAVTVGDVQSSDDSVFTSAVATATSIPEH----------- 97

  Fly   122 YLSG-STVSMGNDLKT-----IVIQQQQTQPGGGGGGANNAGTNTTATNTIGLNHDGSGSNNSHD 180
            .|:| :|:.:||.|.|     ||:...         |:....|:..||.|    ....|....:.
Zfish    98 VLTGRATLQIGNTLSTQKATLIVVHTD---------GSIVDATSLKATGT----PMTPGPQTPNT 149

  Fly   181 SLATLEHAAGGASGVGGGGGGTGGGSSGWSENPSTQHNEVFQIRCKTTCAELYRSKLGSGGRGRC 245
            .||:                |.....|.::.:||...||: .:||:.|...||:::|||||:|||
Zfish   150 PLAS----------------GHDKDVSKYNWDPSVYDNEL-PVRCRNTSGLLYKNRLGSGGKGRC 197

  Fly   246 VKYKDKWHTPSEFEHVCGRGSSKDWKRSIKYGGKSLQSLIDEGTLTPHATNCSCTVCCDD----- 305
            :|:.:.|:||:|||.:.||.|||||||||:|.|:.||.||.|..|.|||.:|:|..||||     
Zfish   198 IKHNNSWYTPTEFEGMSGRASSKDWKRSIRYAGRPLQCLIQERILNPHAASCTCAACCDDLSTVS 262

  Fly   306 ----------EAGESASGPVRLFTPYKRRKRNQTDLDMESGPKRKRNTHHSNN---------NNS 351
                      :...|.:||||||.||||||:   |.:..:.|..|:......|         ..|
Zfish   263 DTCTKEGSYGQESLSMTGPVRLFVPYKRRKK---DNERAASPDNKKEIQSPKNITLAPGATFTVS 324

  Fly   352 NTNNNNTSGSGANNCVDVTAAVAAATASVVDE---------NNMFLS----------EENITSKD 397
            .:...:|||:     :....:.:..|||::.:         |...|:          :..:.||.
Zfish   325 PSGQISTSGT-----LSFDRSASGETASIISDSPAAPDVYTNTTVLTTLPALAVVPQQAVVQSKP 384

  Fly   398 EPWAALNDSLDTSTE--LVDQSQMGNTYERETFVVNINDGSSIAVLDTSQSMKNIEHVYCTMVKA 460
            .|...|.:.|:|..:  .:...:|.||.        :::...:.||.......:....:.|:...
Zfish   385 PPAGTLLNGLETGEQRTWLYLEEMANTL--------LSNVQQLKVLIAQAKQASQSGAHATISPD 441

  Fly   461 TNDFKRMLNDMKQSFERRIEVLQKERDAAVSAMRVQVHADIDDPNISGSLHGNEIISAKKCANCN 525
            .|...|     |:||:.:.. |.:|.:..::                      |||....|.||.
Zfish   442 KNSSGR-----KESFQSQFS-LTEEPEGKIT----------------------EIIIKHTCVNCG 478

  Fly   526 REALAECSLCRKTPYCSEFCQRKDWNAHQVECTRNPQTT 564
            |||..||:.|.|..|||.|||||||..||:.|.: |.|:
Zfish   479 REASCECTGCHKVHYCSGFCQRKDWKEHQLNCCQ-PNTS 516

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Deaf1NP_001262069.1 SAND 219..291 CDD:128554 40/72 (56%)
zf-MYND 521..557 CDD:280009 22/36 (61%)
deaf1XP_005174312.1 SAND 168..242 CDD:279658 40/75 (53%)
zf-MYND 474..510 CDD:280009 22/36 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C304722863
eggNOG 1 0.900 E1_KOG4333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I3844
OMA 1 1.010
OrthoDB 1 1.010 D295114at33208
OrthoFinder 1 1.000 FOG0003735
OrthoInspector 1 1.000 T1052213
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10237
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5158
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.