DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Deaf1 and Deaf1

DIOPT Version :8

Sequence 1:NP_001262069.1 Gene:Deaf1 / 40164 FlyBaseID:FBgn0013799 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_006536267.1 Gene:Deaf1 / 54006 MGIID:1858496 Length:576 Species:Mus musculus

Alignment Length:587 Identity:158/588 (27%)
Similarity:245/588 (42%) Gaps:139/588 (24%)


  Fly    18 AALAEDVVKEEVILESSSHHHHHHHHQLDTKVRMVTSSSNDNSGSGGASGGT-------SGAGGG 75
            ||.|.:...||.:|............:.:.:.|.||:.:...:.||....||       ..|...
Mouse    29 AAAAAESEAEEPVLSRDEDSEEDADSEAERETRRVTAVAVMAAESGHMDMGTEALPSPDEAAAAA 93

  Fly    76 NGGGGVVSVPVSLPIGSMITGTTFNVITPDQLPPHFKPMLCVDNNGYLSGSTVS------MGNDL 134
            .....|.:|.|: .:||    :..||.|..           |.|...:||..:|      :|:.|
Mouse    94 AAFAEVTTVTVA-NVGS----SADNVFTTS-----------VANAASISGHVLSGRTALQIGDSL 142

  Fly   135 KT-----IVIQQQQTQPGGGGGGANNAGTNTTATNTIGLNHDGS----GSNNSHDSLATLEHAAG 190
            .|     ||:.                 |:.:...|.||....:    |..:....||.      
Mouse   143 NTEKATLIVVH-----------------TDGSIVETTGLKGPAAPLTPGPQSPPTPLAP------ 184

  Fly   191 GASGVGGGGGGTGGGSSGWSENPSTQHNEVFQIRCKTTCAELYRSKLGSGGRGRCVKYKDKWHTP 255
                    |...||....|  :||...:|: .:||:.....||:|:|||||||||:|..:.|::|
Mouse   185 --------GQEKGGTKYNW--DPSVYDSEL-PVRCRNISGTLYKSRLGSGGRGRCIKQGENWYSP 238

  Fly   256 SEFEHVCGRGSSKDWKRSIKYGGKSLQSLIDEGTLTPHATNCSCTVCCDDEAGESASGPVRLFTP 320
            :|||.:.||.|||||||||:|.|:.||.||.:|.|.|||.:|:|..||||   .:.|||||||.|
Mouse   239 TEFEAMAGRASSKDWKRSIRYAGRPLQCLIQDGILNPHAASCTCAACCDD---MTLSGPVRLFVP 300

  Fly   321 YKRRKRNQTDLDMESGPKRKRNTHH-------SNNNNSNTNNNNTSGSGA-----NNCVDVTAAV 373
            |||||:..   ::.:.|.:|.:..:       :....:.|.:...:.|||     .:.|:.||.:
Mouse   301 YKRRKKEN---ELPTTPVKKDSPKNITLLPATAATTFTVTPSGQITTSGALTFDRASTVEATAVI 362

  Fly   374 AAATASVVDENNMF----LSEENI-----TSKDEP-WAALNDS----------LDTSTELVDQSQ 418
            :.:.|    :.::|    :.|..:     ....|| :....||          |.||...:..:.
Mouse   363 SESPA----QGDVFAGATVQEAGVQPPCRVGHPEPHYPGYQDSCQIAPFPEAALPTSHPKIVLTS 423

  Fly   419 MGNTYERETFVVNINDGSSIAVLDTSQ--SMKNIEHVYCTMVKATNDFKRMLNDMKQSFERRIEV 481
            :.......:........:.::.|:.|:  |...:|.:..:::......|.:....||:       
Mouse   424 LPALAVPPSTPTKAVSPTVVSGLEMSEHRSWLYLEEMVNSLLNTAQQLKTLFEQAKQA------- 481

  Fly   482 LQKERDAAVSAMRVQVHADIDDPNISGSLHGNEIISAKKCANCNREALAECSLCRKTPYCSEFCQ 546
             ...|:|||:..|:||..:..:               :.|.||.|||::||:.|.|..|||.|||
Mouse   482 -SSCREAAVTQARMQVDTERKE---------------QSCVNCGREAMSECTGCHKVNYCSTFCQ 530

  Fly   547 RK 548
            ||
Mouse   531 RK 532

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Deaf1NP_001262069.1 SAND 219..291 CDD:128554 40/72 (56%)
zf-MYND 521..557 CDD:280009 18/29 (62%)
Deaf1XP_006536267.1 SAND 199..273 CDD:279658 27/74 (36%)
zf-MYND 505..>532 CDD:280009 3/27 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C304723790
eggNOG 1 0.900 E1_KOG4333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 186 1.000 Inparanoid score I3903
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003735
OrthoInspector 1 1.000 T1082888
orthoMCL 1 0.900 OOG5_136457
Panther 1 1.100 LDO PTHR10237
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5158
TreeFam 1 0.960
1110.790

Return to query results.
Submit another query.