DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Deaf1 and Samd11

DIOPT Version :10

Sequence 1:NP_524169.1 Gene:Deaf1 / 40164 FlyBaseID:FBgn0013799 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_006538909.1 Gene:Samd11 / 231004 MGIID:2446220 Length:558 Species:Mus musculus


Alignment Length:72 Identity:20/72 - (27%)
Similarity:31/72 - (43%) Gaps:21/72 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SNDNSG----SGGASGGTS-----GAGGGNG-GGGVVS-------VPVSLPIGSMI----TGTTF 99
            |.|:.|    :..|..|||     .|||... |.|::|       :|:..|.|::.    |||..
Mouse   339 SKDSDGEDPETAAAREGTSTPSQVPAGGTRAEGRGLLSGSTLPPPLPLGFPCGAVSPYFHTGTMG 403

  Fly   100 NVITPDQ 106
            .:.|.::
Mouse   404 GLFTDEE 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Deaf1NP_524169.1 SAND 219..291 CDD:128554
zf-MYND 521..557 CDD:460312
Samd11XP_006538909.1 SAM_Samd7,11 417..484 CDD:188978
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.