DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Deaf1 and gmeb-3

DIOPT Version :8

Sequence 1:NP_001262069.1 Gene:Deaf1 / 40164 FlyBaseID:FBgn0013799 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_497762.2 Gene:gmeb-3 / 175487 WormBaseID:WBGene00008092 Length:376 Species:Caenorhabditis elegans

Alignment Length:317 Identity:64/318 (20%)
Similarity:116/318 (36%) Gaps:71/318 (22%)


  Fly   228 TCA--------ELYRSKLGSGGRGRCVKYKDKWHTPSEFEHVCGRGSSKDWKRSIKYGGKSLQSL 284
            ||.        :|:|.   .|.|..|::|:.::.||.:|..:.|:|..||||..|:....||::|
 Worm    79 TCGYVKGIMHLKLFRC---PGIRQACIEYESQYLTPKQFTELGGKGRQKDWKACIRVENVSLRTL 140

  Fly   285 IDEGTLTPHATNCSCTVCCDDEAGESASG--PVRLFTPYKRRKRNQTDLDMESGPKRKRNTHHSN 347
            ::..|:..:.....|...|......:::|  ||        .||:..|: :.||......|..|:
 Worm   141 LENKTIDFYNHKSICHGQCQSRNYMNSTGRAPV--------NKRHLEDV-LASGDDASEPTEQSS 196

  Fly   348 NNNSN---TNNNNTSGSGANNCVDVTAAVAAATASVVDENNMFLSEE--------NITSKDEP-- 399
            ...|.   ........:|..|       .|....:.|:..:..:.||        ...:.:.|  
 Worm   197 GQISEEPIKKRGRGRPAGKKN-------KAKLEINFVESEDQLVFEEFFQPAFSTRSPAPERPVC 254

  Fly   400 ------WAAL-NDSLDTSTELVDQSQMGNTYERETFVVNINDGSSIAVLDTSQSM------KNIE 451
                  ::.| ||.:...:::          :|..|:....|......::..||.      :|..
 Worm   255 SPAQDIYSCLQNDPMSFWSQI----------KRSGFISQFCDDIIAGAINLKQSAMTQSLNQNSA 309

  Fly   452 HVYCTMVKATNDFKRMLNDMKQSFERRIEVLQKERDAAVSAMRVQVHA-----DIDD 503
            .|......|....|.::|.: ||.||.:...:|:.:......:.|..|     |:|:
 Worm   310 FVLTRATFALGIQKPIVNRV-QSIERNVNEQKKQNEMMEDQGKYQEDAQTEADDLDN 365

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Deaf1NP_001262069.1 SAND 219..291 CDD:128554 22/71 (31%)
zf-MYND 521..557 CDD:280009
gmeb-3NP_497762.2 SAND 74..147 CDD:128554 22/71 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T476691
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.