DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Deaf1 and set-14

DIOPT Version :10

Sequence 1:NP_524169.1 Gene:Deaf1 / 40164 FlyBaseID:FBgn0013799 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_496323.1 Gene:set-14 / 174662 WormBaseID:WBGene00011068 Length:429 Species:Caenorhabditis elegans


Alignment Length:39 Identity:19/39 - (48%)
Similarity:24/39 - (61%) Gaps:2/39 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   521 CANC--NREALAECSLCRKTPYCSEFCQRKDWNAHQVEC 557
            |..|  :...|.:||.||:..|||:.|||.||..|:|||
 Worm    26 CNQCLTSMAELKKCSACRRLAYCSQECQRADWKLHKVEC 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Deaf1NP_524169.1 SAND 219..291 CDD:128554
zf-MYND 521..557 CDD:460312 17/37 (46%)
set-14NP_496323.1 zf-MYND 26..64 CDD:460312 17/37 (46%)
SET 75..241 CDD:394802
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.