DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Deaf1 and GMEB1

DIOPT Version :8

Sequence 1:NP_001262069.1 Gene:Deaf1 / 40164 FlyBaseID:FBgn0013799 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_006573.2 Gene:GMEB1 / 10691 HGNCID:4370 Length:573 Species:Homo sapiens

Alignment Length:452 Identity:97/453 (21%)
Similarity:166/453 (37%) Gaps:124/453 (27%)


  Fly    81 VVSVPVSLPIGSMITGTTFNVITPDQLPPHFKPMLCVDNNGYLSGSTVSMGNDLKT-IVIQQQQT 144
            :.:..||:|:|.:       |:.|.:                  |:......|.|| :::|.|..
Human     1 MANAEVSVPVGDV-------VVVPTE------------------GNEGENPEDTKTQVILQLQPV 40

  Fly   145 QPG---GG--------GGGANNAGTNTTATNTIGLNHDGSGSNNSHDSLATLEHAAGGASGVGGG 198
            |.|   .|        .|..||.......|:||....:|.                         
Human    41 QQGLFIDGHFYNRIYEAGSENNTAVVAVETHTIHKIEEGI------------------------- 80

  Fly   199 GGGTGGGSSGWSENPSTQHNEVFQIRCKTTCAE-----LYRSKLGSGGRGRCVKYKDKWHTPSEF 258
              .||          :.:.||..:|....||.|     |::..:..|...:|||:.|:..:|..|
Human    81 --DTG----------TIEANEDMEIAYPITCGESKAILLWKKFVCPGINVKCVKFNDQLISPKHF 133

  Fly   259 EHVCGRGSSKDWKRSIKYGGKSLQSLIDEGTLTPHATNCSCTVCCD----DEAGESASGPVRLFT 319
            .|:.|:.:.|||||:|:.||..|:.::|.|.:..:..:..|:..|.    |....||..||    
Human   134 VHLAGKSTLKDWKRAIRLGGIMLRKMMDSGQIDFYQHDKVCSNTCRSTKFDLLISSARAPV---- 194

  Fly   320 PYKRRKRNQTDLDMESGPKRKRNTHHSNNNNSNTNNNNTSGSGANNCVDVTAAVAAATASVVDEN 384
            |.::....||....:....:...:..|...         :|...|:.  :||||..||...|.::
Human   195 PGQQTSVVQTPTSADGSITQIAISEESMEE---------AGLEWNSA--LTAAVTMATEEGVKKD 248

  Fly   385 NMFLSEENITSKDEPWAALNDSLDTSTELVDQSQMGNTYERETFVVNINDGSSIAVLDTSQS--M 447
            :..:||:.:..    |..:.| :....|:|...|.    |.|..:..:......|....:.:  :
Human   249 SEEISEDTLMF----WKGIAD-VGLMEEVVCNIQK----EIEELLRGVQQRLIQAPFQVTDAAVL 304

  Fly   448 KNIEHVYCTM--VKATNDFKRMLNDMKQ----------SFERRIEVLQKE-RDAAVSAMRVQ 496
            .|:.|.:..|  ||...|.:|  |.::|          ..||::|..:|: :|..:.:..||
Human   305 NNVAHTFGLMDTVKKVLDNRR--NQVEQGEEQFLYTLTDLERQLEEQKKQGQDHRLKSQTVQ 364

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Deaf1NP_001262069.1 SAND 219..291 CDD:128554 26/77 (34%)
zf-MYND 521..557 CDD:280009
GMEB1NP_006573.2 SAND 91..165 CDD:307487 25/74 (34%)
KDWK motif 143..147 4/4 (100%)
Retinal <374..462 CDD:330657
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.