DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Deaf1 and Samd11

DIOPT Version :8

Sequence 1:NP_001262069.1 Gene:Deaf1 / 40164 FlyBaseID:FBgn0013799 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_008762634.1 Gene:Samd11 / 102549710 RGDID:1310271 Length:665 Species:Rattus norvegicus

Alignment Length:72 Identity:20/73 (27%)
Similarity:29/73 (40%) Gaps:21/73 (29%)


  Fly    56 SNDNSGS--------GGAS-------GGTSGAGGGNGGGGVV--SVPVSLPIGSMI----TGTTF 99
            |.|:.|.        ||||       |||...|.|...|..:  .:|:..|.|::.    |||..
  Rat   447 SKDSDGEDPEIAAARGGASTPSQVPAGGTRAEGKGLLSGSTLPPPLPLGFPCGAVSPYFHTGTMG 511

  Fly   100 NVITPDQ 106
            .:.|.::
  Rat   512 GLFTDEE 518

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Deaf1NP_001262069.1 SAND 219..291 CDD:128554
zf-MYND 521..557 CDD:280009
Samd11XP_008762634.1 SAM_Samd7,11 525..592 CDD:188978
SAM 527..582 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.