DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Deaf1 and deaf1

DIOPT Version :8

Sequence 1:NP_001262069.1 Gene:Deaf1 / 40164 FlyBaseID:FBgn0013799 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_017948878.1 Gene:deaf1 / 100137100 XenbaseID:XB-GENE-1216227 Length:501 Species:Xenopus tropicalis

Alignment Length:375 Identity:131/376 (35%)
Similarity:175/376 (47%) Gaps:50/376 (13%)


  Fly   197 GGGGGTGGGSSG-------WSENPSTQHNEVFQIRCKTTCAELYRSKLGSGGRGRCVKYKDKWHT 254
            |..|.|...|.|       :|.:.|...||: .:||:.....||:::|||||||||||:.|.|:|
 Frog   142 GSEGSTTPLSPGPEKDGTKYSWDSSVYDNEL-PVRCRNISGILYKNRLGSGGRGRCVKHLDGWYT 205

  Fly   255 PSEFEHVCGRGSSKDWKRSIKYGGKSLQSLI------DEGTLTPHATNCSCTVCCDDEAGESASG 313
            |:|.|.:.||.|||||||||:|.|:.||.||      .:|.|||||.:|:|..||||   .|.||
 Frog   206 PTEIEAMAGRASSKDWKRSIRYAGRPLQCLIQPYLCSQDGLLTPHAASCTCAACCDD---LSLSG 267

  Fly   314 PVRLFTPYKRRKRNQTDLDMESGPKRKRNTHHSNNNNSNTNNNNT-SGSGANNCVDVTAAVAAAT 377
            |||||.||||||:   :.::.:.|.:|..|.:........:...| |.||.....|..|...|||
 Frog   268 PVRLFVPYKRRKK---EGELPAVPSKKDPTKNITLLPGTASATFTVSPSGQITATDSLAFERAAT 329

  Fly   378 ASVVDENNMFLSEENITSKDEPWAALNDSLDTSTELVDQSQMGNTYERETFVVNINDGSSIAVLD 442
            |..          ..|.|...|...:.......|.|...:...:|..:||....:|   .:.|.|
 Frog   330 AEA----------SAILSDSPPQGDVYTGPTVLTSLPALALAPSTPTKETSPGGVN---GLEVSD 381

  Fly   443 TSQSMKNIEHVYCTMVKATNDFKRMLNDMKQSFERRIEVLQKERDAAVSAMRVQVHADIDDPNIS 507
            ..:....:|.:..:::......|..::             |.:.:||........|.......|.
 Frog   382 QQRPWLYLEEMVNSLINTAQQLKSFID-------------QAKSEAATDRKEFTGHLFQPADEID 433

  Fly   508 GSLHGNEIISAKKCANCNREALAECSLCRKTPYCSEFCQRKDWNAHQVEC 557
            |.   .||:..:.|.||.||||.||:.|.|..|||.|||||||..||..|
 Frog   434 GK---QEILLRQSCVNCGREALNECTGCHKVNYCSIFCQRKDWKDHQHLC 480

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Deaf1NP_001262069.1 SAND 219..291 CDD:128554 41/78 (53%)
zf-MYND 521..557 CDD:280009 23/36 (64%)
deaf1XP_017948878.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D295114at33208
OrthoFinder 1 1.000 FOG0003735
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.