DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fibp and Fibp

DIOPT Version :8

Sequence 1:NP_001262066.1 Gene:Fibp / 40163 FlyBaseID:FBgn0036911 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001240761.1 Gene:Fibp / 58249 MGIID:1926233 Length:364 Species:Mus musculus

Alignment Length:324 Identity:146/325 (45%)
Similarity:205/325 (63%) Gaps:17/325 (5%)


  Fly     2 GAPSDLIASDVLDHYRTYSLIELYLNAPTKLMEQSCFQLEPQMRDLITEKYYSIDDVVAREILGK 66
            ||.:.::.||.:|||||:.::|..|:||.||:.|..||:.|..:.|:.|:||:.|:...||:|||
Mouse    46 GATTGVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQTLLIERYYTFDEAFVREVLGK 110

  Fly    67 KLSSRYRKDLDEVAEKTCVKLKSVRRQFDNVKRIFKAVEEMPGTLTNNIKQHFIISTDLAKKYAC 131
            |||...:||||:::.||.:.|||.||||||.||:||.||||.|:|.:||:|||::|..||:.||.
Mouse   111 KLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAA 175

  Fly   132 IVFLACLRFETTKKKLQYLSFSDLLTCSHAIMIYWTYTYQHTGP-------EYYDTEMDKEFLLD 189
            |||.|..||||.|||||||||.|...|:..::..||.......|       :..|.::|||||.|
Mouse   176 IVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVGEAPTDPDSQVDDMDVDLDKEFLQD 240

  Fly   190 LRELRCLLDKEKEI----KHLVCMRLKPVLLERAFHELDGNFRSYWRALITIACNLHRNRELRDL 250
            |:||:.|: .:|::    |.|||..|:..|  ..|.|::.||::..|.|:.:|..|..|:::|||
Mouse   241 LKELKVLV-ADKDLLDLHKSLVCTALRGKL--GVFSEMETNFKNLSRGLVNVAAKLTHNKDVRDL 302

  Fly   251 FVDLCEKLIDPWRQNGWNREQVNKFLASITQSVLDLEISRDQETRCLWDRYMQVITICLDKMYH 314
            ||||.||.::|.|.:.|....|..||:..:.||..|:..|.|   .||||||..:..||.::||
Mouse   303 FVDLVEKFVEPCRSDHWPLSDVRLFLSQYSASVHSLDGFRHQ---ALWDRYMGTLRGCLLRLYH 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FibpNP_001262066.1 FIBP 1..314 CDD:283161 145/323 (45%)
FibpNP_001240761.1 FIBP 3..363 CDD:283161 146/325 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C174125669
eggNOG 1 0.900 E1_2CBWY
Hieranoid 1 1.000
Homologene 1 1.000 H3106
Inparanoid 1 1.050 312 1.000 Inparanoid score I2556
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007860
OrthoInspector 1 1.000 T1085113
orthoMCL 1 0.900 OOG5_133964
Panther 1 1.100 LDO PTHR13223
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5694
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.