DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kap-alpha1 and AT1G44120

DIOPT Version :9

Sequence 1:NP_524167.1 Gene:Kap-alpha1 / 40160 FlyBaseID:FBgn0024889 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001321524.1 Gene:AT1G44120 / 841015 AraportID:AT1G44120 Length:2141 Species:Arabidopsis thaliana


Alignment Length:407 Identity:96/407 - (23%)
Similarity:143/407 - (35%) Gaps:90/407 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 LRNSANATLQFEAAWTLTNIASGTSQQTKVVIEAGAVPIFIDLLSSPHD-DVQEQAVWALGNIAG 209
            |..|:|...|..||..|..:....:.....|.|:|||.:.:.||...:. .|:...|.||..|..
plant   225 LLQSSNPVSQSNAASLLARLIRIFTSSISKVEESGAVQVLVQLLGEENSVFVRASVVNALEAITS 289

  Fly   210 DS----PMCRD----HLLGSGILEPLLHVLSNSDRITMIRNAVWTLSNLCRGKSPPADFAKISHG 266
            .|    .:.||    |||.|.::......:.......:.......|:|||.|.|   .......|
plant   290 KSEEAITVARDLDGIHLLISAVVASSKESVEEETERVLQSYGTQALANLCGGMS---GLIVYLGG 351

  Fly   267 LPILARLLKYTDADVLSDTCWAIGYLSDGPNDKIQAVIDAGVCRRLVELLLHPQ--QNVSTAALR 329
            |.:..||.: ..||:|....:|:........|..:| .|..:...::..||.|:  |.:....|.
plant   352 LSLSPRLTE-PIADILGALAYALRKFQLSCGDTREA-FDPTLTEGILVKLLKPRDTQLIHERILE 414

  Fly   330 AV----GNIVTG------DDQQTQVILGYNA--------LTCISHLLHSTAETIKKESCWTISNI 376
            |:    ||:...      |.::..|.|...|        :||:|:|       .|....|.    
plant   415 AMESLFGNVDLSKLLNNVDAKRVLVCLTILATDGPRERMITCLSNL-------CKHGDVWD---- 468

  Fly   377 AAGNREQIQALI-----NANIFPQLMVIMQTAEFKTRKEAAWAITNATSSGTHEQIHYLVQVGCV 436
            |.|.||.||.||     ::....:|.|..........:|:.||:|:|               |.:
plant   469 AIGKREGIQILIPYLGLSSEQHQELSVEFLAILTDNVEESRWAVTSA---------------GGI 518

  Fly   437 PPMCDFLTV-----VDSDIVQVALN-------------------ALENILK-AGEKFQTRPNPYA 476
            ||:...|..     ...|.|:|.||                   ||..:|| .|.|.|.......
plant   519 PPLLQILETGVSQKAKDDAVRVILNLCCHSEEIRLCVEKAGAIPALLGLLKNGGPKSQESSANTL 583

  Fly   477 ITIEECGGLDKIEYLQA 493
            :.:.:......||.:||
plant   584 LKLIKTADPSVIEQVQA 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kap-alpha1NP_524167.1 SRP1 1..543 CDD:227396 96/407 (24%)
IBB 3..116 CDD:280005
ARM 131..252 CDD:237987 29/114 (25%)
armadillo repeat 133..165 CDD:293788 7/18 (39%)
armadillo repeat 173..209 CDD:293788 12/36 (33%)
armadillo repeat 215..250 CDD:293788 7/38 (18%)
ARM 264..378 CDD:237987 29/133 (22%)
armadillo repeat 267..292 CDD:293788 7/24 (29%)
armadillo repeat 300..336 CDD:293788 10/41 (24%)
armadillo repeat 342..376 CDD:293788 9/41 (22%)
ARM 356..461 CDD:237987 29/133 (22%)
armadillo repeat 384..421 CDD:293788 11/41 (27%)
armadillo repeat 427..461 CDD:293788 11/57 (19%)
Arm_3 473..517 CDD:292804 4/21 (19%)
AT1G44120NP_001321524.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.