DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kap-alpha1 and IMPA-2

DIOPT Version :9

Sequence 1:NP_524167.1 Gene:Kap-alpha1 / 40160 FlyBaseID:FBgn0024889 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001154239.1 Gene:IMPA-2 / 827302 AraportID:AT4G16143 Length:535 Species:Arabidopsis thaliana


Alignment Length:547 Identity:272/547 - (49%)
Similarity:358/547 - (65%) Gaps:34/547 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KQRYKNAALDSTEMRRRREEVGIQLRKNKREQQLFKRRNVVLEPATSSTSAGVESNTDNEQQAAD 70
            :.||| .|:|:.|.|||||:..:::||:|||:.|.|:|.           .|:::|  ...|.|.
plant    13 RNRYK-VAVDAEEGRRRREDNMVEIRKSKREESLQKKRR-----------EGLQAN--QLPQFAP 63

  Fly    71 MHMADSSTGGQNEEAAGSGAQPSVINEEMIQMLFSGRENEQLEATQKFRKLLSRDPNPPIEEVIQ 135
            ..:..|||..:..|:..:          |:..::|...:.|||||.:||||||.:.:|||||||.
plant    64 SPVPASSTVEKKLESLPA----------MVGGVWSDDRSLQLEATTQFRKLLSIERSPPIEEVID 118

  Fly   136 KGIVPQFVTFLRNSANATLQFEAAWTLTNIASGTSQQTKVVIEAGAVPIFIDLLSSPHDDVQEQA 200
            .|:||:||.||.......|||||||.|||||||||:.||||||.||||||:.||:|..|||:|||
plant   119 AGVVPRFVEFLTREDYPQLQFEAAWALTNIASGTSENTKVVIEHGAVPIFVQLLASQSDDVREQA 183

  Fly   201 VWALGNIAGDSPMCRDHLLGSGILEPLLHVLSNSDRITMIRNAVWTLSNLCRGKSPPADFAKISH 265
            ||||||:|||||.|||.:||.|.|.|||..|:...:::|:|||.|||||.|||| |...|.::..
plant   184 VWALGNVAGDSPRCRDLVLGQGALIPLLSQLNEHAKLSMLRNATWTLSNFCRGK-PQPPFDQVRP 247

  Fly   266 GLPILARLLKYTDADVLSDTCWAIGYLSDGPNDKIQAVIDAGVCRRLVELLLHPQQNVSTAALRA 330
            .||.|.||:..||.:||:|.|||:.|||||.|||||:||:|||..||||||.|...:|...|||:
plant   248 ALPALERLIHSTDEEVLTDACWALSYLSDGTNDKIQSVIEAGVVPRLVELLQHQSPSVLIPALRS 312

  Fly   331 VGNIVTGDDQQTQVILGYNA-LTCISHLLHSTAETIKKESCWTISNIAAGNREQIQALINANIFP 394
            :||||||||.|||.::.:.| |:.:|.|.|:..::||||:|||||||.||||:||||:..|.:..
plant   313 IGNIVTGDDLQTQCVISHGALLSLLSLLTHNHKKSIKKEACWTISNITAGNRDQIQAVCEAGLIC 377

  Fly   395 QLMVIMQTAEFKTRKEAAWAITNATSSGTHEQIHYLVQVGCVPPMCDFLTVVDSDIVQVALNALE 459
            .|:.::|.|||..:|||||||:||||.|:.:||.|:|:.|.|.|:||.|...|..|:.|.|..||
plant   378 PLVNLLQNAEFDIKKEAAWAISNATSGGSPDQIKYMVEQGVVKPLCDLLVCPDPRIITVCLEGLE 442

  Fly   460 NILKAGEKFQTRPNP-----YAITIEECGGLDKIEYLQAHENRDIYHKSFYIIEQYFGNEEEDSR 519
            ||||.||..:...|.     ||..|::..||:|||.||:|:|.:||.|:..|:|.|:..||:::.
plant   443 NILKVGEAEKVTGNTGDVNFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEEEDETL 507

  Fly   520 VAPVAGTQQFEFDPDN---MPSTGFNF 543
            .......|.|:|...|   :|..||||
plant   508 PPGDPSAQGFQFGGGNDAAVPPGGFNF 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kap-alpha1NP_524167.1 SRP1 1..543 CDD:227396 270/545 (50%)
IBB 3..116 CDD:280005 33/109 (30%)
ARM 131..252 CDD:237987 79/120 (66%)
armadillo repeat 133..165 CDD:293788 18/31 (58%)
armadillo repeat 173..209 CDD:293788 27/35 (77%)
armadillo repeat 215..250 CDD:293788 18/34 (53%)
ARM 264..378 CDD:237987 66/114 (58%)
armadillo repeat 267..292 CDD:293788 13/24 (54%)
armadillo repeat 300..336 CDD:293788 21/35 (60%)
armadillo repeat 342..376 CDD:293788 16/34 (47%)
ARM 356..461 CDD:237987 55/104 (53%)
armadillo repeat 384..421 CDD:293788 19/36 (53%)
armadillo repeat 427..461 CDD:293788 15/33 (45%)
Arm_3 473..517 CDD:292804 21/48 (44%)
IMPA-2NP_001154239.1 IBB 8..99 CDD:280005 33/109 (30%)
SRP1 10..535 CDD:227396 272/547 (50%)
armadillo repeat 79..104 CDD:293788 9/34 (26%)
ARM 114..235 CDD:237987 79/120 (66%)
armadillo repeat 116..148 CDD:293788 18/31 (58%)
armadillo repeat 156..192 CDD:293788 27/35 (77%)
armadillo repeat 198..232 CDD:293788 17/33 (52%)
ARM 248..403 CDD:237987 89/154 (58%)
armadillo repeat 249..274 CDD:293788 13/24 (54%)
armadillo repeat 285..359 CDD:293788 41/73 (56%)
armadillo repeat 367..403 CDD:293788 18/35 (51%)
ARM 368..499 CDD:237987 60/130 (46%)
armadillo repeat 410..444 CDD:293788 15/33 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4139
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H22472
Inparanoid 1 1.050 497 1.000 Inparanoid score I321
OMA 1 1.010 - - QHG54553
OrthoDB 1 1.010 - - D1111872at2759
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 1 1.000 - - otm2570
orthoMCL 1 0.900 - - OOG6_100442
Panther 1 1.100 - - O PTHR23316
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X492
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.